Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen triple helix repeat-containing protein 1 (CTHRC1)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Human CTHRC1 protein

Gene Name

CTHRC1

UniProt

Q96CG8

Expression Region

31-243aa

Organism

Homo sapiens (Human)

Target Sequence

SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell migration

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1 Polyclonal Antibody
RA23925-01 50 µL

Cyclin B1 Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin B1 Polyclonal Antibody
RA23925-02 100 µL

Cyclin B1 Polyclonal Antibody

Sign In for Pricing
View Details
Pter ORF Vector (Rat) (pORF)
ORF074262 1.0 µg DNA

Pter ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Porcine Pulmonary Surfactant-Associated Protein B (SFTPB) ELISA Kit-Sandwich
EK12F659-01 48 Test

Porcine Pulmonary Surfactant-Associated Protein B (SFTPB) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Porcine Pulmonary Surfactant-Associated Protein B (SFTPB) ELISA Kit-Sandwich
EK12F659-02 96 Tests

Porcine Pulmonary Surfactant-Associated Protein B (SFTPB) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Rabbit Monoclonal Ficolin-1 Antibody (001) [DyLight 594]
NBP2-89713DL594 0.1 mL

Rabbit Monoclonal Ficolin-1 Antibody (001) [DyLight 594]

Sign In for Pricing
View Details