CLM9/CD300g, Human (HEK293, His)
Product Specifications
UNSPSC Description
The CLM9/CD300g protein is known as a receptor and is thought to be involved in mediating L-selectin-dependent lymphocyte rolling. This protein exhibits calcium-dependent binding to SELL (L-selectin ligand), indicating its ability to interact with lymphocytes and potentially influence lymphocyte-related processes. CLM9/CD300g Protein, Human (HEK293, His) is the recombinant human-derived CLM9/CD300g protein, expressed by HEK293 , with C-6*His labeled tag.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/clm9-cd300g-clm9-protein-human-hek-293-his.html
Smiles
LEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPGPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLDSTSAEDTSPALSSGSSKPRVSIPMVR
Molecular Weight
Approximately 64.0 kDa
Shipping Conditions
Room temperature
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx520307 96 Tests
Mouse DNA Damage Regulated Autophagy Modulator 1 (DRAM1) ELISA Kit
Sign In for Pricing
View Details 
MBS1578663-01 0.1 mg
Recombinant DENV-2 Protein prM/prM Protein, N-GST & C-His
Sign In for Pricing
View Details 
MBS1578663-02 1 mg
Recombinant DENV-2 Protein prM/prM Protein, N-GST & C-His
Sign In for Pricing
View Details MBS1578663-03 5x 1 mg
Recombinant DENV-2 Protein prM/prM Protein, N-GST & C-His
Sign In for Pricing
View Details 
K1684207 1.0 µg DNA
POLR2K sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
Sign In for Pricing
View Details