Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCA-1/CXCL13, Rat (His-GST)

The BCA-1/CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. As part of this family, BCA-1/CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. BCA-1/CXCL13 Protein, Rat (His-GST) is the recombinant rat-derived BCA-1/CXCL13 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

Product Specifications

Product Name Alternative

BCA-1/CXCL13 Protein, Rat (His-GST), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bca-1-cxcl13-protein-rat-gst.html

Purity

90.00

Smiles

LETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA

Molecular Formula

498335 (Gene_ID) Q5I0J6 (L23-A108) (Accession)

Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNMTL1 ORF Vector (Human) (pORF)
ORF008909 1.0 µg DNA

RNMTL1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
APOC1 Recombinant Monoclonal Antibody
RAC08202-01 50 µL

APOC1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
APOC1 Recombinant Monoclonal Antibody
RAC08202-02 100 µL

APOC1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Anti-REG4 Antibody, Rabbit Polyclonal
MBS8105007-01 0.1 mL

Anti-REG4 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-REG4 Antibody, Rabbit Polyclonal
MBS8105007-02 5x 0.1 mL

Anti-REG4 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Human anti-Hendra Virus fusion glycoprotein (F) IgM
A11A26-M 1 Each

Human anti-Hendra Virus fusion glycoprotein (F) IgM

Sign In for Pricing
View Details