Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCA-1/CXCL13, Rat (His-GST)

The BCA-1/CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. As part of this family, BCA-1/CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. BCA-1/CXCL13 Protein, Rat (His-GST) is the recombinant rat-derived BCA-1/CXCL13 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

Product Specifications

Product Name Alternative

BCA-1/CXCL13 Protein, Rat (His-GST), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bca-1-cxcl13-protein-rat-gst.html

Purity

90.00

Smiles

LETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA

Molecular Formula

498335 (Gene_ID) Q5I0J6 (L23-A108) (Accession)

Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SULT1C1 Protein Vector (Mouse) (pPM-C-HA)
PV235196 500 ng

SULT1C1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) fldA Polyclonal Antibody
MBS7161311 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) fldA Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human TIA1 Protein, N-GST & C-His
E55P5423 50 µg

Recombinant Human TIA1 Protein, N-GST & C-His

Sign In for Pricing
View Details
Kcna6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3403007 1.0 µg DNA

Kcna6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Feline IgG (H+L) Secondary Antibody [Allophycocyanin]
NBP2-60651APC 0.5 mL

Goat Polyclonal Goat anti-Feline IgG (H+L) Secondary Antibody [Allophycocyanin]

Sign In for Pricing
View Details
CAPN1 Protein Vector (Human) (pPB-N-His)
PV007422 500 ng

CAPN1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details