Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCA-1/CXCL13, Rat (His-GST)

The BCA-1/CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. As part of this family, BCA-1/CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. BCA-1/CXCL13 Protein, Rat (His-GST) is the recombinant rat-derived BCA-1/CXCL13 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

Product Specifications

Product Name Alternative

BCA-1/CXCL13 Protein, Rat (His-GST), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bca-1-cxcl13-protein-rat-gst.html

Purity

90.00

Smiles

LETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA

Molecular Formula

498335 (Gene_ID) Q5I0J6 (L23-A108) (Accession)

Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD8 Antibody (37006) [DyLight 755]
FAB1509Z 0.5 mL

Mouse Monoclonal CD8 Antibody (37006) [DyLight 755]

Sign In for Pricing
View Details
Glycerol
40700040-5 18 L

Glycerol

Sign In for Pricing
View Details
CD40 (NM_001250) Human Tagged ORF Clone
RG201977 10 µg

CD40 (NM_001250) Human Tagged ORF Clone

Sign In for Pricing
View Details
Ssxb2 Protein Vector (Mouse) (pPB-C-His)
PV234290 500 ng

Ssxb2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Kif3a (NM_008443) Mouse Recombinant Protein
PM45245M5 20 µg

Kif3a (NM_008443) Mouse Recombinant Protein

Sign In for Pricing
View Details
Human Anti-epstein-barr virus Antibody IgM, Ebv Ab IgM ELISA KIT
ED0240Hu-01 96 Well

Human Anti-epstein-barr virus Antibody IgM, Ebv Ab IgM ELISA KIT

Sign In for Pricing
View Details