Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCA-1/CXCL13, Rat (His-GST)

The BCA-1/CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. As part of this family, BCA-1/CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. BCA-1/CXCL13 Protein, Rat (His-GST) is the recombinant rat-derived BCA-1/CXCL13 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

Product Specifications

Product Name Alternative

BCA-1/CXCL13 Protein, Rat (His-GST), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bca-1-cxcl13-protein-rat-gst.html

Purity

90.00

Smiles

LETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA

Molecular Formula

498335 (Gene_ID) Q5I0J6 (L23-A108) (Accession)

Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Enterobacter Cloacae Antibody (61/212) [HRP]
NB100-62544H 0.1 mL

Mouse Monoclonal Enterobacter Cloacae Antibody (61/212) [HRP]

Sign In for Pricing
View Details
Human Pancreatic Polypeptide (PP) ELISA Kit
MBS267312-01 48 Well

Human Pancreatic Polypeptide (PP) ELISA Kit

Sign In for Pricing
View Details
Human Pancreatic Polypeptide (PP) ELISA Kit
MBS267312-02 96 Well

Human Pancreatic Polypeptide (PP) ELISA Kit

Sign In for Pricing
View Details
Human Pancreatic Polypeptide (PP) ELISA Kit
MBS267312-03 5x 96 Well

Human Pancreatic Polypeptide (PP) ELISA Kit

Sign In for Pricing
View Details
Human Pancreatic Polypeptide (PP) ELISA Kit
MBS267312-04 10x 96 Well

Human Pancreatic Polypeptide (PP) ELISA Kit

Sign In for Pricing
View Details
Calnexin (phospho Ser583) Rabbit Polyclonal Antibody
E28PP0041 100 µL

Calnexin (phospho Ser583) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details