Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCA-1/CXCL13, Rat (His-GST)

The BCA-1/CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. As part of this family, BCA-1/CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. BCA-1/CXCL13 Protein, Rat (His-GST) is the recombinant rat-derived BCA-1/CXCL13 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

Product Specifications

Product Name Alternative

BCA-1/CXCL13 Protein, Rat (His-GST), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bca-1-cxcl13-protein-rat-gst.html

Purity

90.00

Smiles

LETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA

Molecular Formula

498335 (Gene_ID) Q5I0J6 (L23-A108) (Accession)

Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

V1RD1 shRNA (m) Lentiviral Particles
sc-155006-V 200 µL

V1RD1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
UGT1A10 (NM_019075) Human Recombinant Protein
TP302144 20 µg

UGT1A10 (NM_019075) Human Recombinant Protein

Sign In for Pricing
View Details
BP Fluor 350 NHS ester
HY-169754-01 1 mg

BP Fluor 350 NHS ester

Sign In for Pricing
View Details
BP Fluor 350 NHS ester
HY-169754-02 5 mg

BP Fluor 350 NHS ester

Sign In for Pricing
View Details
BP Fluor 350 NHS ester
HY-169754-03 10 mg

BP Fluor 350 NHS ester

Sign In for Pricing
View Details
Glyoxalase I, NT (GLO1, GLOD1, Glx I, GLYI, Aldoketomutase, Ketone-aldehyde Mutase, Lactoylglutathione Lyase, Methylglyoxalase, S-D-lactoylglutathione Methylglyoxal Lyase) (PE) discontinued
G8235-30C-PE 200 µL

Glyoxalase I, NT (GLO1, GLOD1, Glx I, GLYI, Aldoketomutase, Ketone-aldehyde Mutase, Lactoylglutathione Lyase, Methylglyoxalase, S-D-lactoylglutathione Methylglyoxal Lyase) (PE) discontinued

Sign In for Pricing
View Details