Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCA-1/CXCL13, Rat (His-GST)

The BCA-1/CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. As part of this family, BCA-1/CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. BCA-1/CXCL13 Protein, Rat (His-GST) is the recombinant rat-derived BCA-1/CXCL13 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

Product Specifications

Product Name Alternative

BCA-1/CXCL13 Protein, Rat (His-GST), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bca-1-cxcl13-protein-rat-gst.html

Purity

90.00

Smiles

LETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA

Molecular Formula

498335 (Gene_ID) Q5I0J6 (L23-A108) (Accession)

Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMO4 (NM_006769) Human Recombinant Protein
TP303914L 1 mg

LMO4 (NM_006769) Human Recombinant Protein

Sign In for Pricing
View Details
Itga9 (NM_001113514) Mouse Tagged ORF Clone
MR224518 10 µg

Itga9 (NM_001113514) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
KTEL1 (POGLUT1) Human shRNA Plasmid Kit (Locus ID 56983)
TL305852 1 Kit

KTEL1 (POGLUT1) Human shRNA Plasmid Kit (Locus ID 56983)

Sign In for Pricing
View Details
Goat Activin Receptor-Like Kinase 1 (ALK1) ELISA Kit
MBS7258303-01 48 Well

Goat Activin Receptor-Like Kinase 1 (ALK1) ELISA Kit

Sign In for Pricing
View Details
Goat Activin Receptor-Like Kinase 1 (ALK1) ELISA Kit
MBS7258303-02 96 Well

Goat Activin Receptor-Like Kinase 1 (ALK1) ELISA Kit

Sign In for Pricing
View Details
Goat Activin Receptor-Like Kinase 1 (ALK1) ELISA Kit
MBS7258303-03 5x 96 Well

Goat Activin Receptor-Like Kinase 1 (ALK1) ELISA Kit

Sign In for Pricing
View Details