Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCA-1/CXCL13, Rat (His-GST)

The BCA-1/CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. As part of this family, BCA-1/CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. BCA-1/CXCL13 Protein, Rat (His-GST) is the recombinant rat-derived BCA-1/CXCL13 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

Product Specifications

Product Name Alternative

BCA-1/CXCL13 Protein, Rat (His-GST), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bca-1-cxcl13-protein-rat-gst.html

Purity

90.00

Smiles

LETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA

Molecular Formula

498335 (Gene_ID) Q5I0J6 (L23-A108) (Accession)

Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCC-15 Cell Line
CSC-C0507 One Frozen Vial

HCC-15 Cell Line

Sign In for Pricing
View Details
DPEP2 Rabbit pAb
A15502-01 20 µL

DPEP2 Rabbit pAb

Sign In for Pricing
View Details
DPEP2 Rabbit pAb
A15502-02 100 μL

DPEP2 Rabbit pAb

Sign In for Pricing
View Details
DPEP2 Rabbit pAb
A15502-03 500 μL

DPEP2 Rabbit pAb

Sign In for Pricing
View Details
DPEP2 Rabbit pAb
A15502-04 1000 μL

DPEP2 Rabbit pAb

Sign In for Pricing
View Details
Goat Cathepsin D (cath-D) ELISA Kit
NSL0957Gt 96 Tests

Goat Cathepsin D (cath-D) ELISA Kit

Sign In for Pricing
View Details