Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCA-1/CXCL13, Rat (His-GST)

The BCA-1/CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. As part of this family, BCA-1/CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. BCA-1/CXCL13 Protein, Rat (His-GST) is the recombinant rat-derived BCA-1/CXCL13 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

Product Specifications

Product Name Alternative

BCA-1/CXCL13 Protein, Rat (His-GST), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bca-1-cxcl13-protein-rat-gst.html

Purity

90.00

Smiles

LETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA

Molecular Formula

498335 (Gene_ID) Q5I0J6 (L23-A108) (Accession)

Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aimp1 Rat siRNA Oligo Duplex (Locus ID 114632)
SR504653 1 Kit

Aimp1 Rat siRNA Oligo Duplex (Locus ID 114632)

Sign In for Pricing
View Details
SLC39A13 (NM_001128225) Human Over-expression Lysate
LC426936 20 µg

SLC39A13 (NM_001128225) Human Over-expression Lysate

Sign In for Pricing
View Details
Human FUT8 activation kit by CRISPRa
GA101679 1 Kit

Human FUT8 activation kit by CRISPRa

Sign In for Pricing
View Details
Clec12a 3'UTR GFP Stable Cell Line
TU252437 1.0 mL

Clec12a 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Nkx2-3 shRNA (UAS) - Lentiviral mouse Nkx2-3 shRNA (UAS, iRFP) (100)
GTR15242811 1 Vial

Lentiviral mouse Nkx2-3 shRNA (UAS) - Lentiviral mouse Nkx2-3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Mouse Monoclonal JunB/AP-1 Antibody (PCRP-JUNB-3G2) [Biotin]
NBP3-08391B 100 µL

Mouse Monoclonal JunB/AP-1 Antibody (PCRP-JUNB-3G2) [Biotin]

Sign In for Pricing
View Details