BCA-1/CXCL13, Rat (His-GST)
The BCA-1/CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. As part of this family, BCA-1/CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. BCA-1/CXCL13 Protein, Rat (His-GST) is the recombinant rat-derived BCA-1/CXCL13 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.
Product Specifications
Product Name Alternative
BCA-1/CXCL13 Protein, Rat (His-GST), Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/bca-1-cxcl13-protein-rat-gst.html
Purity
90.00
Smiles
LETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA
Molecular Formula
498335 (Gene_ID) Q5I0J6 (L23-A108) (Accession)
Molecular Weight
Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
DST (Dystonin, Bullous Pemphigoid Antigen 1, DT, BPA, DMH, BP240, BPAG1, HSAN6, MACF2, CATX15, CATX-15) (PE)
DST (Dystonin, Bullous Pemphigoid Antigen 1, DT, BPA, DMH, BP240, BPAG1, HSAN6, MACF2, CATX15, CATX-15) (PE)
![DPP9 Mouse Monoclonal Antibody [Clone ID: OTI2D4]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)