BCA-1/CXCL13, Rat (His-GST)
The BCA-1/CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. As part of this family, BCA-1/CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. BCA-1/CXCL13 Protein, Rat (His-GST) is the recombinant rat-derived BCA-1/CXCL13 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.
Product Specifications
Product Name Alternative
BCA-1/CXCL13 Protein, Rat (His-GST), Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/bca-1-cxcl13-protein-rat-gst.html
Purity
90.00
Smiles
LETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA
Molecular Formula
498335 (Gene_ID) Q5I0J6 (L23-A108) (Accession)
Molecular Weight
Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
PCDHAC2 (Protocadherin alpha-C2, MGC71598, PCDH-alpha-C2) (MaxLight 750)
PCDHAC2 (Protocadherin alpha-C2, MGC71598, PCDH-alpha-C2) (MaxLight 750)
Lentiviral human ASCL4 sgRNA gene knockout kit - Lentiviral human ASCL4 sgRNA gene knockout kit (25)
TUBA1C sgRNA CRISPR Lentivector (Human) (Target 1)