Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein C-III/APOC3, Mouse (His-SUMO)

Apolipoprotein C-III (APOC3) is a component of VLDL and HDL and plays a crucial role in triglyceride homeostasis. Intracellularly, it facilitates the assembly and secretion of VLDL1 for lipid transport. Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Apolipoprotein C-III/APOC3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-c-iii-protein-mouse-his-sumo.html

Purity

96.00

Smiles

EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPEDQPTPAIES

Molecular Formula

11814 (Gene_ID) P33622 (E21-S99) (Accession)

Molecular Weight

Approximately 22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATR (FRP1, SCKL1, Ataxia telangiectasia and RAD 3 Related Protein) (MaxLight 750) discontinued
A4020-01B-ML750 100 µL

ATR (FRP1, SCKL1, Ataxia telangiectasia and RAD 3 Related Protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Guinea pig A-kinase anchor protein 13 (AKAP13) ELISA Kit
EIA07188Gu 1 Kit

Guinea pig A-kinase anchor protein 13 (AKAP13) ELISA Kit

Sign In for Pricing
View Details
MCHR2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1279704 1.0 µg DNA

MCHR2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Pdzrn3 (BC010329) Mouse Tagged Lenti ORF Clone
MR209785L3 10 µg

Pdzrn3 (BC010329) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
pLV3×FLAG-EF1a-mCherry-Puro Plasmid
PVT58089 2 µg

pLV3×FLAG-EF1a-mCherry-Puro Plasmid

Sign In for Pricing
View Details
Anti-PDCD1/PD-1/CD279 Antibody (Cemiplimab)
F1136-50 50 mg

Anti-PDCD1/PD-1/CD279 Antibody (Cemiplimab)

Sign In for Pricing
View Details