Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP-6, Human (HEK293, His)

IGFBP-6 protein is an important IGFBP member that regulates insulin-like growth factor (IGF) by changing its interaction with cell surface receptors, thereby affecting IGF-induced growth responses. In addition to regulating IGF signaling, IGFBP-6 also activates the MAPK pathway and induces cell migration. IGFBP-6 Protein, Human (HEK293, His) is the recombinant human-derived IGFBP-6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IGFBP-6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igfbp-6-protein-human-hek293-his.html

Purity

96.60

Smiles

MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG

Molecular Formula

3489 (Gene_ID) P24592 (R28-G240) (Accession)

Molecular Weight

Approximately 30-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CBFB shRNA Plasmid
abx950610-01 150 µg

Human CBFB shRNA Plasmid

Sign In for Pricing
View Details
Human CBFB shRNA Plasmid
abx950610-02 300 µg

Human CBFB shRNA Plasmid

Sign In for Pricing
View Details
LOC100363529 3'UTR Luciferase Stable Cell Line
TU208743 1.0 mL

LOC100363529 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Ndst4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3858405 3x 1.0 µg

Ndst4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
PVRL1 (NECTIN1) Human Over-expression Lysate
orb1355399 100 µg

PVRL1 (NECTIN1) Human Over-expression Lysate

Sign In for Pricing
View Details
IL7 Rabbit Polyclonal Antibody (Fluoro594)
orb3077012 100 µg

IL7 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details