Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP4, Human

RBP4 protein acts as a retinol-binding protein, essential for transporting retinol in blood plasma. It facilitates the delivery of retinol from the liver to peripheral tissues and likely transfers bound all-trans retinol to STRA6 for cell membrane transport. Interactions with TTR prevent kidney glomeruli filtration loss. Direct interaction with STRA6 underscores RBP4's role in intricate retinol transport and distribution processes in the body. RBP4 Protein, Human is the recombinant human-derived RBP4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

RBP4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp4-protein-human.html

Purity

98.0

Smiles

ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Molecular Formula

5950 (Gene_ID) P02753 (E19-L201) (Accession)

Molecular Weight

Approximately 20.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glypican 3 Rabbit pAb
E45R19013N-50 50 µL

Glypican 3 Rabbit pAb

Sign In for Pricing
View Details
ANP32A Rabbit Polyclonal Antibody (Center)
E28PB1222 100 µL

ANP32A Rabbit Polyclonal Antibody (Center)

Sign In for Pricing
View Details
CDC23 Antibody Blocking peptide
orb1447777 500 µg

CDC23 Antibody Blocking peptide

Sign In for Pricing
View Details
Rabbit Polyclonal DCLK1 Antibody [Alexa Fluor 750]
NBP1-77127AF750 0.1 mL

Rabbit Polyclonal DCLK1 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Recombinant Thermus thermophilus Acetylglutamate/acetylaminoadipate kinase (argB)
MBS1468386-01 0.02 mg (E-Coli)

Recombinant Thermus thermophilus Acetylglutamate/acetylaminoadipate kinase (argB)

Sign In for Pricing
View Details
Recombinant Thermus thermophilus Acetylglutamate/acetylaminoadipate kinase (argB)
MBS1468386-02 0.1 mg (E-Coli)

Recombinant Thermus thermophilus Acetylglutamate/acetylaminoadipate kinase (argB)

Sign In for Pricing
View Details