Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uncharacterized protein C1orf54 homolog

Product Specifications

Product Name Alternative

Protein L259

Abbreviation

Recombinant Mouse Uncharacterized protein C1orf54 homolog protein

UniProt

Q8R2K8

Expression Region

17-148aa

Organism

Mus musculus (Mouse)

Target Sequence

QEYDHEEQLEEGDYYQVAYYYYTVTPNYDDFSVNFTVDYSVFESEDRLNRLNKEVTTTEAVETTASSYSLHTELMDPQNPVTTKPVTTEPVTTEPVTTEPQSPNQNDAMSTLQSPVSCFLLWTLLQGGVHFM

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPH3 (NM_206831) Human Recombinant Protein
TP304203M 100 µg

DPH3 (NM_206831) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-Mouse MAdCAM-1 (MECA-89) In Vivo Antibody - Low Endotoxin
ICH1214-5mg 5 mg

Anti-Mouse MAdCAM-1 (MECA-89) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
WTAP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12G6]
TA808376AM 100 µL

WTAP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12G6]

Sign In for Pricing
View Details
1110065P20Rik Mouse Gene Knockout Kit (CRISPR)
KN500033 1 Kit

1110065P20Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tnni2 (NM_009405) Mouse Tagged ORF Clone
MG201648 10 µg

Tnni2 (NM_009405) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
(2R,5S,10aS,10bS)-Octahydro-10b-hydroxy-5-isobutyl-2-isopropyl-3,6-dioxo-8H-oxazolo[3,2-a]pyrrolo[2,1-c]pyrazine-2-carboxylic Acid
TRC-O236475-2.5MG 2.5 mg

(2R,5S,10aS,10bS)-Octahydro-10b-hydroxy-5-isobutyl-2-isopropyl-3,6-dioxo-8H-oxazolo[3,2-a]pyrrolo[2,1-c]pyrazine-2-carboxylic Acid

Sign In for Pricing
View Details