Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhesus Macaque Interleukin-3 protein (IL3) (Active)

Product Specifications

Product Name Alternative

IL-3, Mast cell growth factor, MCGF, Multipotential colony-stimulating factor, P-cell-stimulating factor

Abbreviation

Recombinant Rhesus macaque IL3 protein (Active)

Gene Name

IL3

UniProt

P25140

Expression Region

20-143aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>98% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Assay #1: Fully biologically active when compared to standard. The ED50 as determined by the dose- dependent stimulation of the proliferation of murine NFS-60 cells is less than 5.0 ng/ml, corresponding to a specific activity of > 2 x 105 IU/mg. Assay #2: The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 x 107 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4, 5 % trehalose

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; FUNCTION

Molecular Weight

14.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR9Q2 Human Gene Knockout Kit (CRISPR)
KN418049 1 Kit

OR9Q2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nkap Mouse siRNA Oligo Duplex (Locus ID 67050)
SR413762 1 Kit

Nkap Mouse siRNA Oligo Duplex (Locus ID 67050)

Sign In for Pricing
View Details
KIBRA Polyclonal Antibody, PerCP Conjugated
bs-11570R-PerCP-01 20 µL

KIBRA Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
KIBRA Polyclonal Antibody, PerCP Conjugated
bs-11570R-PerCP-02 100 µL

KIBRA Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Peli1 Rat shRNA Lentiviral Particle (Locus ID 305549)
TL704122V 500 µL Each

Peli1 Rat shRNA Lentiviral Particle (Locus ID 305549)

Sign In for Pricing
View Details
Aquaporin 2 Rabbit mAb Antibody
orb1952190 100 µL

Aquaporin 2 Rabbit mAb Antibody

Sign In for Pricing
View Details