Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF alpha/TGFA, Human (CHO)

TGF-alpha Protein, Human (CHO) is a potent angiogenic mediator and mitogenic polypeptide.

Product Specifications

Product Name Alternative

TGF alpha/TGFA Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tgf-alpha-protein-human-cho.html

Purity

95.0

Smiles

VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Molecular Formula

7039 (Gene_ID) P01135 (V40-A89) (Accession)

Molecular Weight

Approximately 8-10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Schreiber AB, et al. Transforming growth factor-alpha: a more potent angiogenic mediator than epidermal growth factor. Science. 1986 Jun 6;232 (4755) :1250-3.|[2]DuBois RN, et al. Regulation of eicosanoid production and mitogenesis in rat intestinal epithelial cells by transforming growth factor-alpha and phorbol ester. J Clin Invest. 1994 Feb;93 (2) :493-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal Afamin Antibody [Allophycocyanin]
NBP3-00101APC 0.1 mL

Rabbit Polyclonal Afamin Antibody [Allophycocyanin]

Ask
View Details
Cyclic AMP-Responsive Element-Binding Protein 1 (CREB1) Antibody
abx012092 100 µL

Cyclic AMP-Responsive Element-Binding Protein 1 (CREB1) Antibody

Ask
View Details
CNOT2 (CCR4-NOT Transcription Complex Subunit 2, CCR4-associated Factor 2, CDC36, NOT2, HSPC131, MSTP046) (FITC)
MBS6146572-01 0.1 mL

CNOT2 (CCR4-NOT Transcription Complex Subunit 2, CCR4-associated Factor 2, CDC36, NOT2, HSPC131, MSTP046) (FITC)

Ask
View Details
CNOT2 (CCR4-NOT Transcription Complex Subunit 2, CCR4-associated Factor 2, CDC36, NOT2, HSPC131, MSTP046) (FITC)
MBS6146572-02 5x 0.1 mL

CNOT2 (CCR4-NOT Transcription Complex Subunit 2, CCR4-associated Factor 2, CDC36, NOT2, HSPC131, MSTP046) (FITC)

Ask
View Details
KLHL22 Polyclonal Antibody, PerCP Conjugated
bs-7807R-PerCP 100 µL

KLHL22 Polyclonal Antibody, PerCP Conjugated

Ask
View Details
RPLP2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
41988126 3x 1.0µg DNA

RPLP2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Ask
View Details