MIF, Human (N-His, C-Myc)
The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (N-His, C-Myc) is the recombinant human-derived MIF protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.
Product Specifications
Product Name Alternative
MIF Protein, Human (N-His, C-Myc), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mif-protein-human-n-his-c-myc.html
Smiles
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Molecular Formula
4282 (Gene_ID) P14174 (P2-A115) (Accession)
Molecular Weight
Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Escherichia coli, Verotoxin II (E. coli, Shiga-like Toxin II Subunit B, SLT-IIB, SLT-2b, Verocytotoxin 2 Subunit B) discontinued, see V2121-70A
Lentiviral human HNRNPR sgRNA gene knockout kit - Lentiviral human HNRNPR sgRNA gene knockout kit (plasmid)
BID (BH3 interacting Domain Death agonist Isoform 2, FP497, BH3 interacting Domain Death agonist Isoform 2, BID, BH3 interacting Domain Death agonist Isoform 2 Apoptotic Death agonist, Apoptotic Death agonist BID, BH3 interacting Domain Death agonist, HGNC:1050, BH3 interacting Domain Death agonist p11, BH3 interacting Domain Death agonist p13, BH3 interacting Domain Death agonist p15, BID Isoform ES (1b), BID Isoform L (2), Desmocollin type 4, Human BID coding sequence, p11 BID, p13 BID, p15 BID, p22 BID)