MIF, Human (N-His, C-Myc)
The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (N-His, C-Myc) is the recombinant human-derived MIF protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.
Product Specifications
Product Name Alternative
MIF Protein, Human (N-His, C-Myc), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mif-protein-human-n-his-c-myc.html
Smiles
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Molecular Formula
4282 (Gene_ID) P14174 (P2-A115) (Accession)
Molecular Weight
Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Recombinant Proteus mirabilis UPF0178 protein PMI1258 (PMI1258)
Recombinant Proteus mirabilis UPF0178 protein PMI1258 (PMI1258)
Recombinant Proteus mirabilis UPF0178 protein PMI1258 (PMI1258)
Recombinant Proteus mirabilis UPF0178 protein PMI1258 (PMI1258)
Recombinant Proteus mirabilis UPF0178 protein PMI1258 (PMI1258)