MIF, Human (N-His, C-Myc)
The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (N-His, C-Myc) is the recombinant human-derived MIF protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.
Product Specifications
Product Name Alternative
MIF Protein, Human (N-His, C-Myc), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mif-protein-human-n-his-c-myc.html
Smiles
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Molecular Formula
4282 (Gene_ID) P14174 (P2-A115) (Accession)
Molecular Weight
Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Mouse Monoclonal DMPO Nitrone Adduct Antibody (N1664A) [Alexa Fluor 405]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
Mouse Monoclonal DMPO Nitrone Adduct Antibody (N1664A) [Alexa Fluor 405]
