Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Swine Influenza A H1N1 Hemagglutinin Antibody [DyLight 405]
NBP2-41107V 0.1 mL

Rabbit Polyclonal Swine Influenza A H1N1 Hemagglutinin Antibody [DyLight 405]

Sign In for Pricing
View Details
Cyclic (adenosine- (2' −> 5') - monophosphate- adenosine- (3' −> 5') - monophosphate- adenosine- (3' −> 5') - monophosphate) (c[A (2',5') pA (3',5') pA (3',5') p] / 2'3'3'-cAAA / 2'-5',3'-5',3'-5'-c-AMP-AMP-AMP), sodium salt
C 372-025 5x 0.5 µmol

Cyclic (adenosine- (2' −> 5') - monophosphate- adenosine- (3' −> 5') - monophosphate- adenosine- (3' −> 5') - monophosphate) (c[A (2',5') pA (3',5') pA (3',5') p] / 2'3'3'-cAAA / 2'-5',3'-5',3'-5'-c-AMP-AMP-AMP), sodium salt

Sign In for Pricing
View Details
Mouse Cd300lb/CMRF35-like molecule 7 ELISA Kit
E0247Mo 96 Tests

Mouse Cd300lb/CMRF35-like molecule 7 ELISA Kit

Sign In for Pricing
View Details
UBR3 sgRNA CRISPR Lentivector set (Human)
K2578401 3x 1.0 µg

UBR3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Nudt18 Pre-designed siRNA Set A
SI109685A 1 Each

Mouse Nudt18 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human/Mouse UBE2K/E2-25K MAb (Clone 701316)
MAB6609 100 µg

Human/Mouse UBE2K/E2-25K MAb (Clone 701316)

Sign In for Pricing
View Details