Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MIOX Antibody
NBP2-98517-50ul 50 µL

Rabbit Polyclonal MIOX Antibody

Sign In for Pricing
View Details
C1ORF144 (SUZ Domain-Containing Protein 1, SUZ RNA Binding Domain Containing 1)
476670 100 µL

C1ORF144 (SUZ Domain-Containing Protein 1, SUZ RNA Binding Domain Containing 1)

Sign In for Pricing
View Details
Lentiviral human PIN4 shRNA (UAS) - Lentiviral human PIN4 shRNA (UAS, GFP) plasmid
GTR15321601 1 Vial

Lentiviral human PIN4 shRNA (UAS) - Lentiviral human PIN4 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
TRIM38 Antibody
MBS8513710-01 0.1 mg

TRIM38 Antibody

Sign In for Pricing
View Details
TRIM38 Antibody
MBS8513710-02 0.1 mL (AF635)

TRIM38 Antibody

Sign In for Pricing
View Details
TRIM38 Antibody
MBS8513710-03 0.1 mL (AF610)

TRIM38 Antibody

Sign In for Pricing
View Details