Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MARCO Protein, His Tag (MALS verified)
MAR-H5243-1mg 1 mg

Human MARCO Protein, His Tag (MALS verified)

Sign In for Pricing
View Details
Human GRIK2 knockout cell line
ABC-KH6447 1 Vial

Human GRIK2 knockout cell line

Sign In for Pricing
View Details
BID (NM_001196) Human Tagged ORF Clone Lentiviral Particle
RC207261L4V 200 µL

BID (NM_001196) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
BC017647 Protein Vector (Mouse) (pPB-C-His)
PV158534 500 ng

BC017647 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) GAR1 Polyclonal Antibody
MBS7139381 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) GAR1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal GPN3 Antibody [mFluor Violet 610 SE]
NBP3-18861MFV610 0.1 mL

Rabbit Polyclonal GPN3 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details