Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tryptophan Hydroxylase 2 (TPH2) ELISA Kit-Sandwich
EK6F213-01 48 Test

Mouse Tryptophan Hydroxylase 2 (TPH2) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Tryptophan Hydroxylase 2 (TPH2) ELISA Kit-Sandwich
EK6F213-02 96 Tests

Mouse Tryptophan Hydroxylase 2 (TPH2) ELISA Kit-Sandwich

Sign In for Pricing
View Details
ZFP36 (HRP)
581949-01 50 µg

ZFP36 (HRP)

Sign In for Pricing
View Details
ZFP36 (HRP)
581949-02 100 µg

ZFP36 (HRP)

Sign In for Pricing
View Details
Histone H3, acetylated, aa8-19 (Lys14), Human, Control Peptide
H5110-13S 100 µg

Histone H3, acetylated, aa8-19 (Lys14), Human, Control Peptide

Sign In for Pricing
View Details
CD40 (MaxLight 650)
MBS6255649-01 0.1 mL

CD40 (MaxLight 650)

Sign In for Pricing
View Details