Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTN3A2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0201808 1.0 µg DNA

BTN3A2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Fish Desert Hedgehog Protein (DHH) ELISA Kit
MBS9366496 Inquire

Fish Desert Hedgehog Protein (DHH) ELISA Kit

Sign In for Pricing
View Details
CC2D2B (NM_001159747) Human Over-expression Lysate
LS387707-100ug 100 µg

CC2D2B (NM_001159747) Human Over-expression Lysate

Sign In for Pricing
View Details
Gckr Rat siRNA Oligo Duplex (Locus ID 25658)
SR510316 1 Kit

Gckr Rat siRNA Oligo Duplex (Locus ID 25658)

Sign In for Pricing
View Details
MC-VC-PABC-Aur0101 25mg
A13336-25 25 mg

MC-VC-PABC-Aur0101 25mg

Sign In for Pricing
View Details
ACCN5 Protein Vector (Rat) (pPB-N-His)
PV251767 500 ng

ACCN5 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details