Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF4 (FIGF, VEGFD, Vascular endothelial growth factor D, c-Fos-induced growth factor) (MaxLight 650) discontinued
031328-ML650 100 µL

VEGF4 (FIGF, VEGFD, Vascular endothelial growth factor D, c-Fos-induced growth factor) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Biotinylated Human B7-H4 (C-Fc-Avi)
32-11420-100 100 µg

Biotinylated Human B7-H4 (C-Fc-Avi)

Sign In for Pricing
View Details
CTDSP1 Protein Vector (Human) (pPM-C-HA)
PV071247 500 ng

CTDSP1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human Gamma-Glutamyltransferase 1 (gGT1) ELISA Kit
RD-gGT1-Hu-01 96 Tests

Human Gamma-Glutamyltransferase 1 (gGT1) ELISA Kit

Sign In for Pricing
View Details
Human Gamma-Glutamyltransferase 1 (gGT1) ELISA Kit
RD-gGT1-Hu-02 48 Tests

Human Gamma-Glutamyltransferase 1 (gGT1) ELISA Kit

Sign In for Pricing
View Details
Human C7orf66 knockdown cell line
ABC-KD2146 1 Vial

Human C7orf66 knockdown cell line

Sign In for Pricing
View Details