Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMA4 (Proteasome Subunit alpha Type-4, Proteasome Component C9, Macropain Subunit C9, Multicatalytic Endopeptidase Complex Subunit C9, Proteasome Subunit L, PSC9, HC9, MGC111191, MGC12467, MGC24813)
131942 100 µg

PSMA4 (Proteasome Subunit alpha Type-4, Proteasome Component C9, Macropain Subunit C9, Multicatalytic Endopeptidase Complex Subunit C9, Proteasome Subunit L, PSC9, HC9, MGC111191, MGC12467, MGC24813)

Sign In for Pricing
View Details
Factor IX/PTC/F9 Polyclonal Antibody (Capture/Detector)
MBS2578624-01 0.025 mg

Factor IX/PTC/F9 Polyclonal Antibody (Capture/Detector)

Sign In for Pricing
View Details
Factor IX/PTC/F9 Polyclonal Antibody (Capture/Detector)
MBS2578624-02 0.1 mg

Factor IX/PTC/F9 Polyclonal Antibody (Capture/Detector)

Sign In for Pricing
View Details
Factor IX/PTC/F9 Polyclonal Antibody (Capture/Detector)
MBS2578624-03 1 mg

Factor IX/PTC/F9 Polyclonal Antibody (Capture/Detector)

Sign In for Pricing
View Details
Factor IX/PTC/F9 Polyclonal Antibody (Capture/Detector)
MBS2578624-04 5x 1 mg

Factor IX/PTC/F9 Polyclonal Antibody (Capture/Detector)

Sign In for Pricing
View Details
n-Tridecyl-β-D-Maltopyranoside, Sol-Grade
MPD0057K Each

n-Tridecyl-β-D-Maltopyranoside, Sol-Grade

Sign In for Pricing
View Details