Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ID4 Antibody
A60301-100UL 100 µL

ID4 Antibody

Sign In for Pricing
View Details
Sdf2 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6365203 1.0 µg DNA

Sdf2 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
MAVS Recombinant Protein Antigen
NBP2-38613PEP 0.1 mL

MAVS Recombinant Protein Antigen

Sign In for Pricing
View Details
Mal-PEG-SCM, 3.4K
HE022024-3.4K-01 1 g

Mal-PEG-SCM, 3.4K

Sign In for Pricing
View Details
Mal-PEG-SCM, 3.4K
HE022024-3.4K-02 5 g

Mal-PEG-SCM, 3.4K

Sign In for Pricing
View Details
CDK16 Protein Vector (Human) (pPB-N-His)
PV068482 500 ng

CDK16 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details