Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPP1 Rabbit Polyclonal Antibody
TA421055 100 µg

TPP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SAMD4A antibody
70R-3739 50 ug

SAMD4A antibody

Sign In for Pricing
View Details
KDM1B Knockout Cell Lysate
ABC-KC0974 100 µg

KDM1B Knockout Cell Lysate

Sign In for Pricing
View Details
ESM1 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated
bsm-42106M-BF555 100 µL

ESM1 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
EYA3 Polyclonal Antibody
MBS8569740-01 0.1 mL

EYA3 Polyclonal Antibody

Sign In for Pricing
View Details
EYA3 Polyclonal Antibody
MBS8569740-02 0.1 mL (AF405L)

EYA3 Polyclonal Antibody

Sign In for Pricing
View Details