Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P Glycoprotein (ABCB1) (NM_000927) Human Tagged Lenti ORF Clone
RC216080L4 10 µg

P Glycoprotein (ABCB1) (NM_000927) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BAD, phosphorylated (T94) (Bad, Bbc6, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-xL/Bcl-2-associated death promoter)
032411 200 µL

BAD, phosphorylated (T94) (Bad, Bbc6, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-xL/Bcl-2-associated death promoter)

Sign In for Pricing
View Details
Anti-TCEAL1  (2B5)
YF-MA16782 100 ug

Anti-TCEAL1 (2B5)

Sign In for Pricing
View Details
S 25585
HY-107728-01 5 mg

S 25585

Sign In for Pricing
View Details
S 25585
HY-107728-02 10 mg

S 25585

Sign In for Pricing
View Details
S 25585
HY-107728-03 25 mg

S 25585

Sign In for Pricing
View Details