Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Macrophage Inflammatory Protein 1 Beta (MIP1b) ELISA Kit
RDR-MIP1b-Si-01 96 Tests

Monkey Macrophage Inflammatory Protein 1 Beta (MIP1b) ELISA Kit

Sign In for Pricing
View Details
Monkey Macrophage Inflammatory Protein 1 Beta (MIP1b) ELISA Kit
RDR-MIP1b-Si-02 48 Tests

Monkey Macrophage Inflammatory Protein 1 Beta (MIP1b) ELISA Kit

Sign In for Pricing
View Details
Wisp2 (NM_031590) Rat Tagged Lenti ORF Clone
RR209530L1 10 µg

Wisp2 (NM_031590) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human BAMBI Protein
MBS8248591-01 0.01 mg

Recombinant Human BAMBI Protein

Sign In for Pricing
View Details
Recombinant Human BAMBI Protein
MBS8248591-02 0.05 mg

Recombinant Human BAMBI Protein

Sign In for Pricing
View Details
Recombinant Human BAMBI Protein
MBS8248591-03 0.5 mg

Recombinant Human BAMBI Protein

Sign In for Pricing
View Details