Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Toll-like receptor 2 (TLR2) ELISA Kit
GA-E0375HM-01 48 Tests

Human Toll-like receptor 2 (TLR2) ELISA Kit

Sign In for Pricing
View Details
Human Toll-like receptor 2 (TLR2) ELISA Kit
GA-E0375HM-02 96 Tests

Human Toll-like receptor 2 (TLR2) ELISA Kit

Sign In for Pricing
View Details
Fibcd1 Rat shRNA Lentiviral Particle (Locus ID 311861)
TL706378V 500 µL Each

Fibcd1 Rat shRNA Lentiviral Particle (Locus ID 311861)

Sign In for Pricing
View Details
Biotinylated H.pylori flagellin A
DAGA-063-B 1 mg

Biotinylated H.pylori flagellin A

Sign In for Pricing
View Details
GHITM discontinued
343499-01 100 µL

GHITM discontinued

Sign In for Pricing
View Details
GHITM discontinued
343499-02 200 µL

GHITM discontinued

Sign In for Pricing
View Details