Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha Synuclein, phosphorylated (pSer129) (Alpha-Synuclein, Alpha-Synuclein, Isoform NACP140, AlphaSYN, NACP, Non A Beta Component Of AD Amyloid, Non A4 Component Of Amyloid, Non A4 Component Of Amyloid Precursor, Non-A Beta Component Of AD Amyloid, Non-A-Beta Component Of Alzheimers Disease Amyloid, Non-A4 Component Of Amyloid Precursor, Non-A4 Component Of Amyloid, PARK 1, PARK 4, PARK1, PARK4, Parkinson Disease (Autosomal Dominant, Lewy Body) 4, Parkinson Disease Familial 1, SNCA, Alpha (Non A4 Component Of Amyloid Precursor), SYN, Synuclein Alpha, Synuclein Alpha 140, Synuclein, Alpha (Non A4 Component Of Amyloid Precursor), SYUA HUMAN)

385058 100 µL

Alpha Synuclein, phosphorylated (pSer129) (Alpha-Synuclein, Alpha-Synuclein, Isoform NACP140, AlphaSYN, NACP, Non A Beta Component Of AD Amyloid, Non A4 Component Of Amyloid, Non A4 Component Of Amyloid Precursor, Non-A Beta Component Of AD Amyloid, Non-A-Beta Component Of Alzheimers Disease Amyloid, Non-A4 Component Of Amyloid Precursor, Non-A4 Component Of Amyloid, PARK 1, PARK 4, PARK1, PARK4, Parkinson Disease (Autosomal Dominant, Lewy Body) 4, Parkinson Disease Familial 1, SNCA, Alpha (Non A4 Component Of Amyloid Precursor), SYN, Synuclein Alpha, Synuclein Alpha 140, Synuclein, Alpha (Non A4 Component Of Amyloid Precursor), SYUA HUMAN)

Sign In for Pricing

Recombinant Shigella dysenteriae serotype 1 Adenylosuccinate synthetase (purA)

MBS1447122-01 0.02 mg (E-Coli)

Recombinant Shigella dysenteriae serotype 1 Adenylosuccinate synthetase (purA)

Sign In for Pricing

Recombinant Shigella dysenteriae serotype 1 Adenylosuccinate synthetase (purA)

MBS1447122-02 0.02 mg (Yeast)

Recombinant Shigella dysenteriae serotype 1 Adenylosuccinate synthetase (purA)

Sign In for Pricing

Recombinant Shigella dysenteriae serotype 1 Adenylosuccinate synthetase (purA)

MBS1447122-03 0.1 mg (E-Coli)

Recombinant Shigella dysenteriae serotype 1 Adenylosuccinate synthetase (purA)

Sign In for Pricing

Recombinant Shigella dysenteriae serotype 1 Adenylosuccinate synthetase (purA)

MBS1447122-04 0.1 mg (Yeast)

Recombinant Shigella dysenteriae serotype 1 Adenylosuccinate synthetase (purA)

Sign In for Pricing

Recombinant Shigella dysenteriae serotype 1 Adenylosuccinate synthetase (purA)

MBS1447122-05 0.02 mg (Baculovirus)

Recombinant Shigella dysenteriae serotype 1 Adenylosuccinate synthetase (purA)

Sign In for Pricing