Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Asn (Trt) TentaGel® R PHB Resin
RA1304.1G 1 g

Fmoc-Asn (Trt) TentaGel® R PHB Resin

Sign In for Pricing
View Details
Human PYDC1 qPCR Primer Pair
QH70353S 200 Tests

Human PYDC1 qPCR Primer Pair

Sign In for Pricing
View Details
CLTB (Clathrin Light Chain B, Lcb)
125100 100 µg

CLTB (Clathrin Light Chain B, Lcb)

Sign In for Pricing
View Details
C8orf31 Protein Vector (Human) (pPB-C-His)
PV006877 500 ng

C8orf31 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PCMV-EGFP-PDGFRA-Neo Plasmid
PVT71094 2 µg

PCMV-EGFP-PDGFRA-Neo Plasmid

Sign In for Pricing
View Details
NYREN18 (NUB1) (NM_016118) Human Recombinant Protein
PH38223M5 20 µg

NYREN18 (NUB1) (NM_016118) Human Recombinant Protein

Sign In for Pricing
View Details