Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WEE2 siRNA Oligos set (Human)
50395171 3x 5 nmol

WEE2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Mouse Monoclonal EVA1/MPZL2 Antibody (OTI2C7) [Alexa Fluor 594]
NBP2-71553AF594 0.1 mL

Mouse Monoclonal EVA1/MPZL2 Antibody (OTI2C7) [Alexa Fluor 594]

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. indica Phospholipase A1-II 3 (OsI_03088)
MBS1033629-01 0.02 mg (E-Coli)

Recombinant Oryza sativa subsp. indica Phospholipase A1-II 3 (OsI_03088)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. indica Phospholipase A1-II 3 (OsI_03088)
MBS1033629-02 0.02 mg (Yeast)

Recombinant Oryza sativa subsp. indica Phospholipase A1-II 3 (OsI_03088)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. indica Phospholipase A1-II 3 (OsI_03088)
MBS1033629-03 0.1 mg (E-Coli)

Recombinant Oryza sativa subsp. indica Phospholipase A1-II 3 (OsI_03088)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. indica Phospholipase A1-II 3 (OsI_03088)
MBS1033629-04 0.1 mg (Yeast)

Recombinant Oryza sativa subsp. indica Phospholipase A1-II 3 (OsI_03088)

Sign In for Pricing
View Details