Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHYKPL (5-Phosphohydroxy-L-Lysine Phospho-Lyase, Alanine-Glyoxylate Aminotransferase 2-Like 2)
488613 100 µL

PHYKPL (5-Phosphohydroxy-L-Lysine Phospho-Lyase, Alanine-Glyoxylate Aminotransferase 2-Like 2)

Sign In for Pricing
View Details
Lipase, Endothelial (LIPG) Antibody
abx006704-01 20 µL

Lipase, Endothelial (LIPG) Antibody

Sign In for Pricing
View Details
Lipase, Endothelial (LIPG) Antibody
abx006704-02 100 µL

Lipase, Endothelial (LIPG) Antibody

Sign In for Pricing
View Details
Lipase, Endothelial (LIPG) Antibody
abx006704-03 2x 100 µL

Lipase, Endothelial (LIPG) Antibody

Sign In for Pricing
View Details
Biotin-Linked Anti-Secreted Frizzled Related Protein 4 (SFRP4)
FY-AB42252-01 1 mL

Biotin-Linked Anti-Secreted Frizzled Related Protein 4 (SFRP4)

Sign In for Pricing
View Details
Biotin-Linked Anti-Secreted Frizzled Related Protein 4 (SFRP4)
FY-AB42252-02 100 µL

Biotin-Linked Anti-Secreted Frizzled Related Protein 4 (SFRP4)

Sign In for Pricing
View Details