Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIGD4 Antibody
GWB-MS813C 50 µg

TIGD4 Antibody

Sign In for Pricing
View Details
Lentiviral human SCFD2 shRNA (UAS) - Lentiviral human SCFD2 shRNA (UAS, iRFP) (25)
GTR15147974 1 Vial

Lentiviral human SCFD2 shRNA (UAS) - Lentiviral human SCFD2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Rat Noa1 Pre-designed siRNA Set A
SI209399A 1 Each

Rat Noa1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Interleukin 7 Receptor alpha (IL7Ra, CD127, CD127 Antigen, CDw127, IL-7R-alpha, ILRA) (FITC) discontinued
I8429-27F 100 µg

Interleukin 7 Receptor alpha (IL7Ra, CD127, CD127 Antigen, CDw127, IL-7R-alpha, ILRA) (FITC) discontinued

Sign In for Pricing
View Details
tert-Butyl Isocyanide
TRC-B689820-25G 25 g

tert-Butyl Isocyanide

Sign In for Pricing
View Details
Dog Vascular Endothelial Growth Factor B (VEGFB) Protein
abx166359-01 50 µg

Dog Vascular Endothelial Growth Factor B (VEGFB) Protein

Sign In for Pricing
View Details