Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal ABCC4 Antibody, Clone: 2D2A9
AMM02940G 0.1ml

Monoclonal ABCC4 Antibody, Clone: 2D2A9

Sign In for Pricing
View Details
MRPS28 sgRNA CRISPR Lentivector (Human) (Target 3)
K1337504 1.0 µg DNA

MRPS28 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Talin 1 (TLN1) Human shRNA Plasmid Kit (Locus ID 7094)
TR308796 1 Kit

Talin 1 (TLN1) Human shRNA Plasmid Kit (Locus ID 7094)

Sign In for Pricing
View Details
Annexin A7 Polyclonal Antibody
bs-4901R 100 µL

Annexin A7 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-MPO Antibody (8Z615)
MF-0080337-01 50 µL

Anti-MPO Antibody (8Z615)

Sign In for Pricing
View Details
Anti-MPO Antibody (8Z615)
MF-0080337-02 100 µL

Anti-MPO Antibody (8Z615)

Sign In for Pricing
View Details