Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-rat-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

286939 (Gene_ID) Q8K1G0 (T18-M232) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCNP Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-6392R-BF555 100 µL

PCNP Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Alpha-Fetoprotein (AFP), Human Cord Serum
P1297-100 each

Alpha-Fetoprotein (AFP), Human Cord Serum

Sign In for Pricing
View Details
Human Syncollin CLIA Kit
MBS8425956-01 1 Kit

Human Syncollin CLIA Kit

Sign In for Pricing
View Details
Human Syncollin CLIA Kit
MBS8425956-02 5x 1 Kit

Human Syncollin CLIA Kit

Sign In for Pricing
View Details
ALB, CT (Serum Albumin, GIG20, GIG42, PRO0903, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696/PRO1341, DKFZp779N1935, PRO0883, PRO1341) (AP) discontinued
A1274-88A-AP 200 µL

ALB, CT (Serum Albumin, GIG20, GIG42, PRO0903, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696/PRO1341, DKFZp779N1935, PRO0883, PRO1341) (AP) discontinued

Sign In for Pricing
View Details
Calcitonin Receptor (CALCR, CRT, CTR, CT-R, CTR1) (MaxLight 490)
124249-ML490 100 µL

Calcitonin Receptor (CALCR, CRT, CTR, CT-R, CTR1) (MaxLight 490)

Sign In for Pricing
View Details