Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-5, Mouse (His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html

Purity

98.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCI-H929/NF-kB Reporter (Luc) stable cell line
GTR15424178 1 Vial

NCI-H929/NF-kB Reporter (Luc) stable cell line

Sign In for Pricing
View Details
Cl-amidine 50mg
A12256-50 50 mg

Cl-amidine 50mg

Sign In for Pricing
View Details
Rabbit Anti-Rat ICAM-1 monoclonal antibody, clone S148
CABT-ZB569 50 μl

Rabbit Anti-Rat ICAM-1 monoclonal antibody, clone S148

Sign In for Pricing
View Details
MYO1E Antibody, Biotin conjugated
A55378-100UG 100 µg

MYO1E Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse Anxa11 Pre-designed siRNA Set A
SI100713A 1 Each

Mouse Anxa11 Pre-designed siRNA Set A

Sign In for Pricing
View Details
TXNRD1/Thioredoxin Reductase 1 Rabbit pAb
E2381968 100 µL

TXNRD1/Thioredoxin Reductase 1 Rabbit pAb

Sign In for Pricing
View Details