Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-5, Mouse (His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html

Purity

98.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound Fr12940
MF-0007441-01 1 g

Compound Fr12940

Sign In for Pricing
View Details
Compound Fr12940
MF-0007441-02 50 mg

Compound Fr12940

Sign In for Pricing
View Details
Compound Fr12940
MF-0007441-03 200 mg

Compound Fr12940

Sign In for Pricing
View Details
Mir450b Mouse qPCR Template Standard (MI0004705)
MK300317 200 Reactions

Mir450b Mouse qPCR Template Standard (MI0004705)

Sign In for Pricing
View Details
GMPPA (Mannose-1-phosphate Guanyltransferase alpha, GDP-mannose Pyrophosphorylase A, GTP-mannose-1-phosphate Guanylyltransferase alpha) (MaxLight 405) discontinued
127400-ML405 100 µL

GMPPA (Mannose-1-phosphate Guanyltransferase alpha, GDP-mannose Pyrophosphorylase A, GTP-mannose-1-phosphate Guanylyltransferase alpha) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CCPG1 Polyclonal Antibody
E55A04267 100 µg

CCPG1 Polyclonal Antibody

Sign In for Pricing
View Details