Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-5, Mouse (His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html

Purity

98.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ATP6V0D2 Antibody
NBP1-54857 100 µL

Rabbit Polyclonal ATP6V0D2 Antibody

Sign In for Pricing
View Details
ANXA3 Antibody
A53046-50UL 50 μL

ANXA3 Antibody

Sign In for Pricing
View Details
Mouse CXCR6 Phycoerythrin MAb (Clone 221002)
FAB2145P-025 25 Tests

Mouse CXCR6 Phycoerythrin MAb (Clone 221002)

Sign In for Pricing
View Details
Dnajc5b ORF Vector (Rat) (pORF)
ORF066129 1.0 µg DNA

Dnajc5b ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Clostridium Perfringens rplL Protein (aa 1-121)
VAng-Lsx00743-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Perfringens rplL Protein (aa 1-121)

Sign In for Pricing
View Details
Retro-2 cycl
MBS3843505-01 5 mg

Retro-2 cycl

Sign In for Pricing
View Details