Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-5, Mouse (His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html

Purity

98.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Allograft Inflammatory Factor 1 (Aif1) Elisa Kit
EKC41348 96 Tests

Human Allograft Inflammatory Factor 1 (Aif1) Elisa Kit

Sign In for Pricing
View Details
CD8B1, CT (CD8B, CD8B1, T-cell surface glycoprotein CD8 beta chain, CD8b) (MaxLight 405) discontinued
033550-ML405 100 µL

CD8B1, CT (CD8B, CD8B1, T-cell surface glycoprotein CD8 beta chain, CD8b) (MaxLight 405) discontinued

Sign In for Pricing
View Details
DPH5 Knockout jurkat Polyclonal Cells
ARG39654 1 Million

DPH5 Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details
Polyclonal LPAR1 / LPA1 / EDG2 Antibody (aa5-54)
APR08258G 0.05ml

Polyclonal LPAR1 / LPA1 / EDG2 Antibody (aa5-54)

Sign In for Pricing
View Details
PARVB (NM_013327) Human Tagged ORF Clone
RC208490 10 µg

PARVB (NM_013327) Human Tagged ORF Clone

Sign In for Pricing
View Details
Apparicine
MBS5790835 Inquire

Apparicine

Sign In for Pricing
View Details