Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-5, Mouse (His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html

Purity

98.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish G-Protein Coupled Receptor 15 (GPR15) ELISA Kit
MBS9909377 Inquire

Fish G-Protein Coupled Receptor 15 (GPR15) ELISA Kit

Sign In for Pricing
View Details
Pentoxazone
TRC-P110960-1G 1 g

Pentoxazone

Sign In for Pricing
View Details
Ucma (NM_001113558) Mouse Tagged ORF Clone
MR220762 10 µg

Ucma (NM_001113558) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Olr1597 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV631058 1.0 µg DNA

Olr1597 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
SLC39A1 Recombinant Protein (Mouse)
RP173102 100 µg

SLC39A1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Anti-Human MRPL48 Polyclonal Antibody
HA917014-01 50 µg

Anti-Human MRPL48 Polyclonal Antibody

Sign In for Pricing
View Details