Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-5, Mouse (His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html

Purity

98.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Antimony Potassium (+L) Tartrate AR
1012860 100 100 g

Antimony Potassium (+L) Tartrate AR

Sign In for Pricing
View Details
Dynactin p150Glued Recombinant Rabbit mAb
E43S49356 100 µL

Dynactin p150Glued Recombinant Rabbit mAb

Sign In for Pricing
View Details
Rat Monoclonal HSF1 Antibody (10H8)
NBP1-97504-0.05mg 0.05 mg

Rat Monoclonal HSF1 Antibody (10H8)

Sign In for Pricing
View Details
Rabbit Anti-MOB1A Polyclonal Antibody
PAV2337 100 μL

Rabbit Anti-MOB1A Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Usf1 shRNA (UAS) - Lentiviral mouse Usf1 shRNA (UAS) (25)
GTR15212429 1 Vial

Lentiviral mouse Usf1 shRNA (UAS) - Lentiviral mouse Usf1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Keratin 14 Antibody / Cytokeratin 14 / KRT14
V9666SAF-100UG 100 µg

Keratin 14 Antibody / Cytokeratin 14 / KRT14

Sign In for Pricing
View Details