Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-5, Mouse (His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html

Purity

98.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Leukocyte cell-derived chemotaxin 1,LECT1 ELISA KIT
ELI-14444Ra 96 Tests

Rabbit Leukocyte cell-derived chemotaxin 1,LECT1 ELISA KIT

Sign In for Pricing
View Details
Pnldc1 3'UTR GFP Stable Cell Line
TU166613 1.0 mL

Pnldc1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal HNF-3 alpha/FoxA1 Antibody (3B11NB) [Alexa Fluor 350]
NBP2-45269AF350 0.1 mL

Mouse Monoclonal HNF-3 alpha/FoxA1 Antibody (3B11NB) [Alexa Fluor 350]

Sign In for Pricing
View Details
Mouse TMC5 shRNA Plasmid
abx978224-01 150 µg

Mouse TMC5 shRNA Plasmid

Sign In for Pricing
View Details
Mouse TMC5 shRNA Plasmid
abx978224-02 300 µg

Mouse TMC5 shRNA Plasmid

Sign In for Pricing
View Details
Biotinylated Human IL-2 (C-6His-Avi)
32-11431-20 20 µg

Biotinylated Human IL-2 (C-6His-Avi)

Sign In for Pricing
View Details