Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-5, Mouse (His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html

Purity

98.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BH3 Interacting Domain Death Agonist (Bid) Antibody
abx175576-01 200 µg

BH3 Interacting Domain Death Agonist (Bid) Antibody

Sign In for Pricing
View Details
BH3 Interacting Domain Death Agonist (Bid) Antibody
abx175576-02 1 mg

BH3 Interacting Domain Death Agonist (Bid) Antibody

Sign In for Pricing
View Details
hsa-miR-4445-3p miRNA Inhibitor
MIH02322 2x 5.0 nmol

hsa-miR-4445-3p miRNA Inhibitor

Sign In for Pricing
View Details
RPL12P29 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV776439 1.0 µg DNA

RPL12P29 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
ICAM1 Mouse Monoclonal Antibody [Clone ID: MEM-112]
BM2449P 100 µg

ICAM1 Mouse Monoclonal Antibody [Clone ID: MEM-112]

Sign In for Pricing
View Details
Ces1e sgRNA CRISPR Lentivector set (Mouse)
K3728501 3x 1.0 µg

Ces1e sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details