Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-5, Mouse (His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html

Purity

98.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

4932425I24Rik 3'UTR Luciferase Stable Cell Line
TU100817 1.0 mL

4932425I24Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ARHGAP22 Blocking Peptide
abx063936-01 1 mg

ARHGAP22 Blocking Peptide

Sign In for Pricing
View Details
ARHGAP22 Blocking Peptide
abx063936-02 5 mg

ARHGAP22 Blocking Peptide

Sign In for Pricing
View Details
TSSK3 (Testis-Specific Serine Kinase 3, SPOGA3, STK22C, STK22D) (MaxLight 650)
253078-ML650 100 µL

TSSK3 (Testis-Specific Serine Kinase 3, SPOGA3, STK22C, STK22D) (MaxLight 650)

Sign In for Pricing
View Details
CARD11 (NM_032415) Human Tagged ORF Clone Lentiviral Particle
RC222740L4V 200 µL

CARD11 (NM_032415) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Lifr (NM_001113386) AAV Particle
MR210267A1V 250 µL

Mouse Lifr (NM_001113386) AAV Particle

Sign In for Pricing
View Details