Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-5, Mouse (His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html

Purity

98.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (MS4A1) Mouse Monoclonal Antibody [Clone ID: UMAB39]
UM800003CF 100 µg

CD20 (MS4A1) Mouse Monoclonal Antibody [Clone ID: UMAB39]

Sign In for Pricing
View Details
DDX56 Mouse Monoclonal Antibody [Clone ID: OTI5A9]
TA802823 100 µL

DDX56 Mouse Monoclonal Antibody [Clone ID: OTI5A9]

Sign In for Pricing
View Details
Protein FAM47A (FAM47A) Human ELISA Kit
G3122 96 Tests

Protein FAM47A (FAM47A) Human ELISA Kit

Sign In for Pricing
View Details
Phf14 (NM_001168382) Mouse Tagged Lenti ORF Clone
MR225145L3 10 µg

Phf14 (NM_001168382) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SDLL4, Recombinant, Human (Delta-like Protein 4, Drosophila Delta Homolog 4, Delta4, UNQ1895/PRO4341, MGC126344) discontinued
143307-01 5 µg

SDLL4, Recombinant, Human (Delta-like Protein 4, Drosophila Delta Homolog 4, Delta4, UNQ1895/PRO4341, MGC126344) discontinued

Sign In for Pricing
View Details
SDLL4, Recombinant, Human (Delta-like Protein 4, Drosophila Delta Homolog 4, Delta4, UNQ1895/PRO4341, MGC126344) discontinued
143307-02 25 µg

SDLL4, Recombinant, Human (Delta-like Protein 4, Drosophila Delta Homolog 4, Delta4, UNQ1895/PRO4341, MGC126344) discontinued

Sign In for Pricing
View Details