Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-5, Mouse (His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html

Purity

98.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Pyridinoline crosslinks,PYD ELISA KIT
JOT-EK1456Hu 96 wells

Human Pyridinoline crosslinks,PYD ELISA KIT

Sign In for Pricing
View Details
RAP2B (Ras-related Protein Rap-2b, MGC20484) (MaxLight 550)
132304-ML550 100 µL

RAP2B (Ras-related Protein Rap-2b, MGC20484) (MaxLight 550)

Sign In for Pricing
View Details
Kcnh5 ORF Vector (Rat) (pORF)
ORF068932 1.0 µg DNA

Kcnh5 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
MCCC1 Protein Vector (Rat) (pPB-N-His)
PV281463 500 ng

MCCC1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Brilliant Violet 510™ anti-human CD49d
GT08065 100 Tests

Brilliant Violet 510™ anti-human CD49d

Sign In for Pricing
View Details
Mouse neutrophil gelatinase-associated lipocalin (NGAL) ELISA Kit
QY-E21086 96 Tests

Mouse neutrophil gelatinase-associated lipocalin (NGAL) ELISA Kit

Sign In for Pricing
View Details