Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-5, Mouse (His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html

Purity

98.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Or13n4 qPCR Primer Pair
QM66338S 200 Tests

Mouse Or13n4 qPCR Primer Pair

Sign In for Pricing
View Details
Rat CHRM2 (Cholinergic Receptor, Muscarinic 2) ELISA Kit
EK246042 96 Well

Rat CHRM2 (Cholinergic Receptor, Muscarinic 2) ELISA Kit

Sign In for Pricing
View Details
Man1a2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3656906 1.0 µg DNA

Man1a2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Shigella Boydii thyA Protein (aa 1-264)
VAng-Lsx08886-500gEcoli 500 µg (E. coli)

Recombinant Shigella Boydii thyA Protein (aa 1-264)

Sign In for Pricing
View Details
Recombinant Streptococcus mutans Lantibiotic mutacin-2 (mutA)
MBS1166081-01 0.02 mg (E-Coli)

Recombinant Streptococcus mutans Lantibiotic mutacin-2 (mutA)

Sign In for Pricing
View Details
Recombinant Streptococcus mutans Lantibiotic mutacin-2 (mutA)
MBS1166081-02 0.1 mg (E-Coli)

Recombinant Streptococcus mutans Lantibiotic mutacin-2 (mutA)

Sign In for Pricing
View Details