Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-5, Mouse (His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html

Purity

98.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TAC1 shRNA (UAS) - Lentiviral human TAC1 shRNA (UAS, GFP) plasmid
GTR15336337 1 Vial

Lentiviral human TAC1 shRNA (UAS) - Lentiviral human TAC1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human Polo-Like Kinase 2 (PLK2) Elisa Kit
EK716336 96 Well

Human Polo-Like Kinase 2 (PLK2) Elisa Kit

Sign In for Pricing
View Details
TIFAB Protein Vector (Rat) (pPB-C-His)
PV310830 500 ng

TIFAB Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Histidine biosynthesis bifunctional protein HisIE (hisI)
MBS1465135-01 0.02 mg (E-Coli)

Recombinant Xylella fastidiosa Histidine biosynthesis bifunctional protein HisIE (hisI)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Histidine biosynthesis bifunctional protein HisIE (hisI)
MBS1465135-02 0.1 mg (E-Coli)

Recombinant Xylella fastidiosa Histidine biosynthesis bifunctional protein HisIE (hisI)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Histidine biosynthesis bifunctional protein HisIE (hisI)
MBS1465135-03 0.02 mg (Yeast)

Recombinant Xylella fastidiosa Histidine biosynthesis bifunctional protein HisIE (hisI)

Sign In for Pricing
View Details