Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-5, Mouse (His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html

Purity

98.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cacna1e sgRNA CRISPR Lentivector set (Rat)
K6909501 3x 1.0 µg

Cacna1e sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
CDO Antibody
C12181-01 50 μL

CDO Antibody

Sign In for Pricing
View Details
CDO Antibody
C12181-02 100 µL

CDO Antibody

Sign In for Pricing
View Details
KPNA2 Protein Vector (Rat) (pPB-C-His)
PV276686 500 ng

KPNA2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Perfringens Supplement-II
62598-1 5 x5 vl

Perfringens Supplement-II

Sign In for Pricing
View Details
RDX (Radixin, DFNB24) (FITC)
MBS6174946-01 0.1 mL

RDX (Radixin, DFNB24) (FITC)

Sign In for Pricing
View Details