Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-5, Mouse (His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html

Purity

98.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALR2 Polyclonal Antibody
RA25211-01 50 µL

GALR2 Polyclonal Antibody

Sign In for Pricing
View Details
GALR2 Polyclonal Antibody
RA25211-02 100 µL

GALR2 Polyclonal Antibody

Sign In for Pricing
View Details
(3S,6R,7S,8S,12Z,15S,16E) -1,3,7,15-Tetrakis-{[tert-butyl (dimethyl) silyl]oxy}-4,4,6,8,12,16-hexamethyl-17- (2-methyl-1,3-thiazol-4-yl) heptadeca-12,16-dien-5-one
T2976-01 500 µg

(3S,6R,7S,8S,12Z,15S,16E) -1,3,7,15-Tetrakis-{[tert-butyl (dimethyl) silyl]oxy}-4,4,6,8,12,16-hexamethyl-17- (2-methyl-1,3-thiazol-4-yl) heptadeca-12,16-dien-5-one

Sign In for Pricing
View Details
Mouse Monoclonal TRAILR2/TNFRSF10B Antibody (B-K29) [Janelia Fluor 635]
NBP3-14595JF635 0.1 mL

Mouse Monoclonal TRAILR2/TNFRSF10B Antibody (B-K29) [Janelia Fluor 635]

Sign In for Pricing
View Details
RPL18A Overexpression Lysate (Native) - (Dry Ice)
NBL1-15512 0.1 mg

RPL18A Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Mouse Anti-Porcine GABA Receptor-Associated Protein Like 1 (GABARAPL1) Monoclonal Antibody
VD8N320 1 Each

Mouse Anti-Porcine GABA Receptor-Associated Protein Like 1 (GABARAPL1) Monoclonal Antibody

Sign In for Pricing
View Details