Animal-Free IL-5, Mouse (His)
IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.Animal-Free IL-5 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-5 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-5 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-5-protein-mouse-his.html
Purity
98.0
Smiles
MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
Molecular Formula
16191 (Gene_ID) P04401 (M21-G133) (Accession)
Molecular Weight
Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
CSPS (Catecholamine-Sulfating Phenol Sulfotransferase) discontinued
Recombinant Ascaris suum V-type proton ATPase 16 kDa proteolipid subunit (12), partial
Receptor-Interacting Protein 3 (RIP3) Antibody (ATTO 655)
Hypoxia Inducible Factor 1 Alpha (HIF1a) Antibody
Hypoxia Inducible Factor 1 Alpha (HIF1a) Antibody