Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARC, Human

ARC Protein, Human that exists in monomeric, oligomeric forms and is capable of reversible self-oligomerization. ARC Protein is a master regulator of long-term synaptic plasticity and memory[1].

Product Specifications

Product Name Alternative

ARC Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/arc-protein-human.html

Purity

95.0

Smiles

MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS

Molecular Formula

8996 (Gene_ID) O60936 (M1-S208) (Accession)

Molecular Weight

Approximately 29.0 kDa

References & Citations

[1]Craig Myrum, et al. Arc Is a Flexible Modular Protein Capable of Reversible Self-Oligomerization. Biochem J. 2015 May 15;468 (1) :145-58.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
38488061 1.0 µg DNA

RANP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Donkey Chondrolectin (CHODL) ELISA Kit
MBS9932788 Inquire

Donkey Chondrolectin (CHODL) ELISA Kit

Sign In for Pricing
View Details
Anti-FBXW2 Antibody
A11297-2 100 µg/Vial

Anti-FBXW2 Antibody

Sign In for Pricing
View Details
Human Gastric Mucin,GM ELISA Kit
CN-04582H1 96T

Human Gastric Mucin,GM ELISA Kit

Sign In for Pricing
View Details
Mitogen-Activated Protein Kinase 1 / ERK2 (MAPK1) Antibody
abx404689-01 100 µL

Mitogen-Activated Protein Kinase 1 / ERK2 (MAPK1) Antibody

Sign In for Pricing
View Details
Mitogen-Activated Protein Kinase 1 / ERK2 (MAPK1) Antibody
abx404689-02 200 µL

Mitogen-Activated Protein Kinase 1 / ERK2 (MAPK1) Antibody

Sign In for Pricing
View Details