Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UPAR, Human (HEK293, His)

The uPAR protein is a receptor for urokinase plasminogen activator and actively localizes and promotes plasmin formation. It mediates proteolysis-independent signaling activated by U-PA and undergoes negative feedback regulation. uPAR Protein, Human (HEK293, His) is the recombinant human-derived uPAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

UPAR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/upar-protein-human-hek-293-his.html

Purity

98.0

Smiles

LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYR

Molecular Formula

5329 (Gene_ID) Q03405-1 (L23-R303) (Accession)

Molecular Weight

Approximately 52 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-Enterobacteria phage H19B Shiga-like toxin 1 subunit B polyclonal Antibody(stxB), FITC
MBS1495609-01 0.05 mg

Rabbit anti-Enterobacteria phage H19B Shiga-like toxin 1 subunit B polyclonal Antibody(stxB), FITC

Ask
View Details
Rabbit anti-Enterobacteria phage H19B Shiga-like toxin 1 subunit B polyclonal Antibody(stxB), FITC
MBS1495609-02 0.1 mg

Rabbit anti-Enterobacteria phage H19B Shiga-like toxin 1 subunit B polyclonal Antibody(stxB), FITC

Ask
View Details
Rabbit anti-Enterobacteria phage H19B Shiga-like toxin 1 subunit B polyclonal Antibody(stxB), FITC
MBS1495609-03 5x 0.1 mg

Rabbit anti-Enterobacteria phage H19B Shiga-like toxin 1 subunit B polyclonal Antibody(stxB), FITC

Ask
View Details
BAP1, CT (Ubiquitin Carboxyl-terminal Hydrolase BAP1, BRCA1-associated Protein 1, Cerebral Protein 6, KIAA0272, Hucep-6) ) (Biotin) discontinued
B0076-12C-Biotin 200 µL

BAP1, CT (Ubiquitin Carboxyl-terminal Hydrolase BAP1, BRCA1-associated Protein 1, Cerebral Protein 6, KIAA0272, Hucep-6) ) (Biotin) discontinued

Ask
View Details
Rat Phosphatidylinositol Transfer Protein Beta Isoform (PITPNB) ELISA Kit
MBS9942726-01 48 Well

Rat Phosphatidylinositol Transfer Protein Beta Isoform (PITPNB) ELISA Kit

Ask
View Details
Rat Phosphatidylinositol Transfer Protein Beta Isoform (PITPNB) ELISA Kit
MBS9942726-02 96 Well

Rat Phosphatidylinositol Transfer Protein Beta Isoform (PITPNB) ELISA Kit

Ask
View Details