Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Cotton Rat (His)

IL-13 protein is a cytokine involved in allergic inflammation, immune response to parasites, and B cell proliferation. IL-13 Protein, Cotton Rat is the recombinant rat-derived IL-13 protein, expressed by E. coli , with N-6*His.

Product Specifications

Product Name Alternative

IL-13 Protein, Cotton Rat (His), Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-cotton-rat.html

Purity

96.00

Smiles

APGPVPRCMSPPMALKELIEELSNITQDQRAPLCNGSMVWSVDLTAGGFCGALDSLTNISSCKPIYKTQRLLNALCTRKASVGVSRLPDTKIEVVQFITTLLNYSKQLYRCGTFH

Molecular Formula

/ (Gene_ID) AAP93198 (A19-H133) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NFATC3/NFAT4 Protein - (Dry Ice)
H00004775-P01-25ug 25 µg

Recombinant Human NFATC3/NFAT4 Protein - (Dry Ice)

Sign In for Pricing
View Details
GDN Rabbit Polyclonal Antibody (BF680)
orb2372574 100 µL

GDN Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
PRL ELISA Kit (Mouse)
OKCD06891-96W 96 Well

PRL ELISA Kit (Mouse)

Sign In for Pricing
View Details
Monkey UBC (Urinary Bladder Cancer Antigen) ELISA Kit
MBS2512318-01 24 Tests

Monkey UBC (Urinary Bladder Cancer Antigen) ELISA Kit

Sign In for Pricing
View Details
Monkey UBC (Urinary Bladder Cancer Antigen) ELISA Kit
MBS2512318-02 48 Tests

Monkey UBC (Urinary Bladder Cancer Antigen) ELISA Kit

Sign In for Pricing
View Details
Monkey UBC (Urinary Bladder Cancer Antigen) ELISA Kit
MBS2512318-03 96 Tests

Monkey UBC (Urinary Bladder Cancer Antigen) ELISA Kit

Sign In for Pricing
View Details