Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMPR, Human (HEK293, His)

GMP reductase 1 (GMPR1) catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. GMPR1 functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. GMPR1 contributes to non-shivering thermogenesis while promoting the progression of Alzheimer's disease. GMPR Protein, Human (HEK293, His) is the recombinant human-derived GMPR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GMPR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmpr-protein-human-hek-293-his.html

Smiles

MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS

Molecular Formula

2766 (Gene_ID) AAH08281.1 (M1-S345) (Accession)

Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Interleukin 18 Receptor 1 (IL18R1) ELISA Kit
MBS2022137-01 24 Strip Well

Human Interleukin 18 Receptor 1 (IL18R1) ELISA Kit

Ask
View Details
Human Interleukin 18 Receptor 1 (IL18R1) ELISA Kit
MBS2022137-02 48 Well

Human Interleukin 18 Receptor 1 (IL18R1) ELISA Kit

Ask
View Details
Human Interleukin 18 Receptor 1 (IL18R1) ELISA Kit
MBS2022137-03 96 Well

Human Interleukin 18 Receptor 1 (IL18R1) ELISA Kit

Ask
View Details
Human Interleukin 18 Receptor 1 (IL18R1) ELISA Kit
MBS2022137-04 5x 96 Well

Human Interleukin 18 Receptor 1 (IL18R1) ELISA Kit

Ask
View Details
Human Interleukin 18 Receptor 1 (IL18R1) ELISA Kit
MBS2022137-05 10x 96 Well

Human Interleukin 18 Receptor 1 (IL18R1) ELISA Kit

Ask
View Details
ARG2 Antibody
MBS7115951-01 0.05 mg

ARG2 Antibody

Ask
View Details