Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMPR, Human (HEK293, His)

GMP reductase 1 (GMPR1) catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. GMPR1 functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. GMPR1 contributes to non-shivering thermogenesis while promoting the progression of Alzheimer's disease. GMPR Protein, Human (HEK293, His) is the recombinant human-derived GMPR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GMPR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmpr-protein-human-hek-293-his.html

Smiles

MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS

Molecular Formula

2766 (Gene_ID) AAH08281.1 (M1-S345) (Accession)

Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Anti-Human RGS10 pAb
PA17153-01 50 μL

Rabbit Anti-Human RGS10 pAb

Ask
View Details
Rabbit Anti-Human RGS10 pAb
PA17153-02 100 μL

Rabbit Anti-Human RGS10 pAb

Ask
View Details
Tmem201 ORF Vector (Mouse) (pORF)
46987015 1.0 µg DNA

Tmem201 ORF Vector (Mouse) (pORF)

Ask
View Details
Mouse HVEM/TNFRSF14 Alexa Fluor 350 Antibody (Clone 2024B)
FAB2516U-100UG 100 µg

Mouse HVEM/TNFRSF14 Alexa Fluor 350 Antibody (Clone 2024B)

Ask
View Details
KLF10 (EGRA, TIEG, TIEG1, Kruppel-like Factor 10)
377161 100 µg

KLF10 (EGRA, TIEG, TIEG1, Kruppel-like Factor 10)

Ask
View Details
GFP hsa-miR-6730-5p AAV miRNA Vector
Amh1233500 500 ng

GFP hsa-miR-6730-5p AAV miRNA Vector

Ask
View Details