Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMPR, Human (HEK293, His)

GMP reductase 1 (GMPR1) catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. GMPR1 functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. GMPR1 contributes to non-shivering thermogenesis while promoting the progression of Alzheimer's disease. GMPR Protein, Human (HEK293, His) is the recombinant human-derived GMPR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GMPR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmpr-protein-human-hek-293-his.html

Smiles

MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS

Molecular Formula

2766 (Gene_ID) AAH08281.1 (M1-S345) (Accession)

Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCPH1, NT (MCPH1, Microcephalin) (APC)
MBS6319761-01 0.2 mL

MCPH1, NT (MCPH1, Microcephalin) (APC)

Sign In for Pricing
View Details
MCPH1, NT (MCPH1, Microcephalin) (APC)
MBS6319761-02 5x 0.2 mL

MCPH1, NT (MCPH1, Microcephalin) (APC)

Sign In for Pricing
View Details
Recombinant Human 43348 Protein, His, E.coli-1mg
QP10914-1mg 1mg

Recombinant Human 43348 Protein, His, E.coli-1mg

Sign In for Pricing
View Details
Recombinant Ehrlichia chaffeensis NADH-quinone oxidoreductase subunit B (nuoB)
MBS1470287-01 0.02 mg (E-Coli)

Recombinant Ehrlichia chaffeensis NADH-quinone oxidoreductase subunit B (nuoB)

Sign In for Pricing
View Details
Recombinant Ehrlichia chaffeensis NADH-quinone oxidoreductase subunit B (nuoB)
MBS1470287-02 0.1 mg (E-Coli)

Recombinant Ehrlichia chaffeensis NADH-quinone oxidoreductase subunit B (nuoB)

Sign In for Pricing
View Details
Recombinant Ehrlichia chaffeensis NADH-quinone oxidoreductase subunit B (nuoB)
MBS1470287-03 0.02 mg (Yeast)

Recombinant Ehrlichia chaffeensis NADH-quinone oxidoreductase subunit B (nuoB)

Sign In for Pricing
View Details