Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMPR, Human (HEK293, His)

GMP reductase 1 (GMPR1) catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. GMPR1 functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. GMPR1 contributes to non-shivering thermogenesis while promoting the progression of Alzheimer's disease. GMPR Protein, Human (HEK293, His) is the recombinant human-derived GMPR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GMPR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmpr-protein-human-hek-293-his.html

Smiles

MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS

Molecular Formula

2766 (Gene_ID) AAH08281.1 (M1-S345) (Accession)

Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Igfbp1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6775204 1.0 µg DNA

Igfbp1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Dcdc2a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4061607 1.0 µg DNA

Dcdc2a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal Sin Nombre Virus Nucleocapsid Antibody [Alexa Fluor 405]
NBP2-41257AF405 0.1 mL

Rabbit Polyclonal Sin Nombre Virus Nucleocapsid Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
CAMK1 delta Antibody / CAMK1D
F54910-0.4ML 0.4 mL

CAMK1 delta Antibody / CAMK1D

Sign In for Pricing
View Details
Pcdhga5 (NM_001037137) Rat Tagged ORF Clone Lentiviral Particle
RR211110L4V 200 µL

Pcdhga5 (NM_001037137) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Histone H3 (acetyl K14) Rabbit mAb
E60M1319 100 µL

Histone H3 (acetyl K14) Rabbit mAb

Sign In for Pricing
View Details