Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Cytolethal distending toxin subunit A (cdtA)

Product Specifications

Product Name Alternative

Cytolethal distending toxin subunit A (CDT A)

Abbreviation

Recombinant E.coli cdtA protein

Gene Name

CdtA

UniProt

Q46668

Expression Region

22-258aa

Organism

Escherichia coli

Target Sequence

CSSGKNKAYLDPKVFPPQVEGGPTVPSPDEPGLPLPGPGPALPTNGAIPIPEPGTAPAVSLMNMDGSVLTMWSRGAGSSLWAYYIGDSNSFGELRNWQIMPGTRPNTIQFRNVDVGTCMTSFPGFKGGVQLSTAPCKFGPERFDFQPMATRNGNYQLKSLSTGLCIRANFLGRTPSSPYATTLTMERCPSSGEKNFEFMWSISEPLRPALATIAKPEIRPFPPQPIEPDEHSTGGEQ

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

CDTs are cytotoxins which induce host cell distension, growth arrest in G2/M phase, nucleus swelling, and chromatin fragmentation in HeLa cells. CdtA, along with CdtC, probably forms a heterodimeric subunit required for the delivery of CdtB.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.5 kDa

References & Citations

"Cloning, sequencing, and expression of the Escherichia coli cytolethal distending toxin genes." Pickett C.L., Cottle D.L., Pesci E.C., Bikah G. Infect. Immun. 62:1046-1051 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnase1l2 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6297502 1.0 µg DNA

Rnase1l2 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Human Phospholipase D2 (PLD2) CLIA Kit
abx494410-01 96 Tests

Human Phospholipase D2 (PLD2) CLIA Kit

Sign In for Pricing
View Details
Human Phospholipase D2 (PLD2) CLIA Kit
abx494410-02 5x 96 Tests

Human Phospholipase D2 (PLD2) CLIA Kit

Sign In for Pricing
View Details
Human Phospholipase D2 (PLD2) CLIA Kit
abx494410-03 10x 96 Tests

Human Phospholipase D2 (PLD2) CLIA Kit

Sign In for Pricing
View Details
IL-7RA&TSLPR, Human (HEK293, Fc)
HY-P704720 100 µg

IL-7RA&TSLPR, Human (HEK293, Fc)

Sign In for Pricing
View Details
INSR Antibody
A51976-50UG 50 µg

INSR Antibody

Sign In for Pricing
View Details