Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK9 Matched ELISA Antibody Pair Set, Rat

Product Specifications

CAS Number

7732-18-5

Gene Name

[PCSK9]

Storage Conditions

Capture Antibody: Aliquot and store at -20 degree C to -80 degree C for up to 6 months from date of receipt. Avoid repeated freeze-thaw cycles.<br>Detection Antibody: Store at 4 degree C and protect it from prolonged exposure to light for up to 6 months from date of receipt. DO NOT FREEZE!<br>Standard: Store lyophilized standard at -20 degree C to -80 degree C for up to 6 months from date of receipt. Aliquot and store the reconstituted Standard at -80 degree C for up to 1 month. Avoid repeated freeze-thaw cycles.

Specificity

Quantitative determination of Rat PCSK9

Short Name

[PCSK9]

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Mouse IL-17 RA/IL-17 R Protein (Fc Tag)
MBS2581379-01 0.02 mg

Recombinant Mouse IL-17 RA/IL-17 R Protein (Fc Tag)

Ask
View Details
Recombinant Mouse IL-17 RA/IL-17 R Protein (Fc Tag)
MBS2581379-02 0.1 mg

Recombinant Mouse IL-17 RA/IL-17 R Protein (Fc Tag)

Ask
View Details
Recombinant Mouse IL-17 RA/IL-17 R Protein (Fc Tag)
MBS2581379-03 5x 0.1 mg

Recombinant Mouse IL-17 RA/IL-17 R Protein (Fc Tag)

Ask
View Details
Rat Anti-Mouse CD106/VCAM-1, Antibody
GWB-39A780 0.5 mg

Rat Anti-Mouse CD106/VCAM-1, Antibody

Ask
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MBS5818163 Inquire

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Ask
View Details
0.22um Butterfly filter ASSY accessory, import
CFA-022-FI 1 PCS/Bag

0.22um Butterfly filter ASSY accessory, import

Ask
View Details