Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL4A1, Human (GST)

COL4A1 protein is an important type IV collagen component that forms the main structural framework of the glomerular basement membrane (GBM) with a unique "chicken wire" mesh structure. It cooperates with laminin, proteoglycans and nestin/nesidin to maintain the structural integrity of GBM. COL4A1 Protein, Human (GST) is the recombinant human-derived COL4A1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

COL4A1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/col4a1-protein-human-gst.html

Purity

95.00

Smiles

GCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVP

Molecular Formula

1282 (Gene_ID) P02462 (G30-P167) (Accession)

Molecular Weight

Approximately 42 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-BMP8B Antibody
DL92147A-01 50 µL

Rabbit anti-BMP8B Antibody

Sign In for Pricing
View Details
Rabbit anti-BMP8B Antibody
DL92147A-02 100 µL

Rabbit anti-BMP8B Antibody

Sign In for Pricing
View Details
Recombinant HIV-1 nef Protein, Untagged, E.coli-1mg
QP14022-1mg 1mg

Recombinant HIV-1 nef Protein, Untagged, E.coli-1mg

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At1g16700 Polyclonal Antibody
MBS9012646 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At1g16700 Polyclonal Antibody

Sign In for Pricing
View Details
N-Methyl Piperazine 99% For Synthesis
01739 00100 100 mL

N-Methyl Piperazine 99% For Synthesis

Sign In for Pricing
View Details
Affinity Purified Anti-HUMAN IgG F(ab )2 (RABBIT)
GWB-43F409 10 mg

Affinity Purified Anti-HUMAN IgG F(ab )2 (RABBIT)

Sign In for Pricing
View Details