Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AK3L1 Baculovirus-Insect cells Overexpression Lysate

Product Specifications

Gene Name

[AK4]

NCBI Gene ID

205

Storage Conditions

Store at 4 degree C for up to twelve months from date of receipt. After re-dissolution, aliquot and store at -80 degree C for up to twelve months. Avoid repeated freeze-thaw cycles.<br>Samples are stable for up to twelve months from date of receipt.

Other Gene Names

[AK4; AK4; AK3; AK 4; AK3L1; AK3L2; ]

Short Name

[AK3L1]

Other Product Names

[Adenylate kinase 4, mitochondrial; Adenylate kinase 4, mitochondrial; adenylate kinase 4, mitochondrial; AK4; AK 4; adenylate kinase 3-like 1; ATP-AMP transphosphorylase; mitochondrial adenylate kinase-3; nucleoside-triphosphate-adenylate kinase; adenylate kinase isoenzyme 4, mitochondrial; GTP:AMP phosphotransferase AK4, m; adenylate kinase 4; Adenylate kinase 3-like; GTP:AMP phosphotransferase AK4]

NCBI GI Number

125157

NCBI Accession Number

P27144.1

Uniprot Accession Number

P27144

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arhgef38 Mouse shRNA Plasmid (Locus ID 77669)
TL514810 1 Kit

Arhgef38 Mouse shRNA Plasmid (Locus ID 77669)

Sign In for Pricing
View Details
PFKFB2 (Biotin)
572013-01 50 µg

PFKFB2 (Biotin)

Sign In for Pricing
View Details
PFKFB2 (Biotin)
572013-02 100 µg

PFKFB2 (Biotin)

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MBS5818163 Inquire

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
Muscle Actin
PM365-3ml 3 mL

Muscle Actin

Sign In for Pricing
View Details
Lentiviral human TYW3 shRNA (UAS) - Lentiviral human TYW3 shRNA (UAS, RFP) (25)
GTR15346886 1 Vial

Lentiviral human TYW3 shRNA (UAS) - Lentiviral human TYW3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details