What is the catalog number for AIMP2, Human (His)?

The catalog number for AIMP2, Human (His) is HY-P71538.

What sizes are available for AIMP2, Human (His)?

AIMP2, Human (His) is available in the following size(s): 1 Each.

Is AIMP2, Human (His) in stock?

AIMP2, Human (His) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures AIMP2, Human (His)?

AIMP2, Human (His) is manufactured by QuantiMol.

What is the estimated delivery time for AIMP2, Human (His)?

Estimated delivery time for AIMP2, Human (His) is approximately 15 business day(s), depending on your location.

AIMP2, Human (His)

AIMP2 Protein, Human (His) plays a primary role in the initiation of α-synuclein (aSyn) aggregation.

Product Specifications

Product Name Alternative

AIMP2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aimp2-protein-human-his.html

Smiles

MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK

Molecular Formula

7965 (Gene_ID) Q13155 (M1-K320) (Accession)

Molecular Weight

Approximately 39.3 kDa

References & Citations

[1]Hilal A Lashuel, et al. Lewy body-associated proteins: victims, instigators, or innocent bystanders? The case of AIMP2 and alpha-synuclein. Neurobiol Dis. 2021 Aug;156:105417.