Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Noelin-3 (Olfm3)

Product Specifications

Product Name Alternative

(Olfactomedin-3) (Optimedin)

Abbreviation

Recombinant Rat Olfm3 protein

Gene Name

Olfm3

UniProt

P63057

Expression Region

24-478aa

Organism

Rattus norvegicus (Rat)

Target Sequence

QTLPSLVGLNTTRLSAPDTLTQISPKEGWQVYSSAQDPDGRCICTVVAPEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQMKGLKAKFRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNLSSVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKITGPITVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNGSLYFNKYQSNIIIKYSFDLGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLMADEIGLWAVYATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYSYSTKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNNGHQVLFNVTLFHIIKTEDDT

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

56.0 kDa

References & Citations

"High-resolution proteomics unravel architecture and molecular diversity of native AMPA receptor complexes." Schwenk J., Harmel N., Brechet A., Zolles G., Berkefeld H., Muller C.S., Bildl W., Baehrens D., Huber B., Kulik A., Klocker N., Schulte U., Fakler B. Neuron 74:621-633 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Corin Rat siRNA Oligo Duplex (Locus ID 289596)
SR513450 1 Kit

Corin Rat siRNA Oligo Duplex (Locus ID 289596)

Sign In for Pricing
View Details
TNFRSF4 Human Recombinant Protein
TP727744 10 µg

TNFRSF4 Human Recombinant Protein

Sign In for Pricing
View Details
FAM32A (NM_014077) Human Over-expression Lysate
LY415497 100 µg

FAM32A (NM_014077) Human Over-expression Lysate

Sign In for Pricing
View Details
Aspartate Aminotransferase (AST) Recombinant, Mouse
153614-01 10 µg

Aspartate Aminotransferase (AST) Recombinant, Mouse

Sign In for Pricing
View Details
Aspartate Aminotransferase (AST) Recombinant, Mouse
153614-02 50 µg

Aspartate Aminotransferase (AST) Recombinant, Mouse

Sign In for Pricing
View Details
Aspartate Aminotransferase (AST) Recombinant, Mouse
153614-03 200 µg

Aspartate Aminotransferase (AST) Recombinant, Mouse

Sign In for Pricing
View Details