Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chicken Olfactory Receptor 5AU1 (OR5AU1) ELISA Kit

Product Specifications

CAS Number

7732-18-5

Gene Name

[OR5AU1]

NCBI Gene ID

390445

Reactivity

Chicken

Storage Conditions

Store at 2-8 degree C.<br>The stability of kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition.

Other Gene Names

[OR5AU1; OR5AU1; OR14-38]

Short Name

[Olfactory Receptor 5AU1 (OR5AU1)]

Other Product Names

[olfactory receptor 5AU1; Olfactory receptor 5AU1; olfactory receptor 5AU1; olfactory receptor family 5 subfamily AU member 1; Olfactory receptor OR14-38]

NCBI GI Number

1511202135

NCBI Accession Number

NP_001004731.2

NCBI GB Accession Number

NM_001004731.2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ndufa6 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6162603 1.0 µg DNA

Ndufa6 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Human PBMC Separation Solution (P 1.077)
E-CK-A103 200 mL

Human PBMC Separation Solution (P 1.077)

Sign In for Pricing
View Details
PJA2 Protein Vector (Rat) (pPM-C-His)
PV294217 500 ng

PJA2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MBS5818163 Inquire

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
LINGO3, CT (LINGO3, LERN2, LRRN6B, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3, Leucine-rich repeat neuronal protein 2, Leucine-rich repeat neuronal protein 6B) (AP)
MBS6316361-01 0.2 mL

LINGO3, CT (LINGO3, LERN2, LRRN6B, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3, Leucine-rich repeat neuronal protein 2, Leucine-rich repeat neuronal protein 6B) (AP)

Sign In for Pricing
View Details
LINGO3, CT (LINGO3, LERN2, LRRN6B, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3, Leucine-rich repeat neuronal protein 2, Leucine-rich repeat neuronal protein 6B) (AP)
MBS6316361-02 5x 0.2 mL

LINGO3, CT (LINGO3, LERN2, LRRN6B, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3, Leucine-rich repeat neuronal protein 2, Leucine-rich repeat neuronal protein 6B) (AP)

Sign In for Pricing
View Details