Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-11, Cynomolgus

IL-11 protein is a potent cytokine that significantly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to megakaryocyte maturation and platelet production. It also promotes hepatocyte proliferation in response to liver injury. IL-11 Protein, Cynomolgus is the recombinant cynomolgus-derived IL-11 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-11 Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-11-protein-cynomolgus.html

Purity

97.00

Smiles

PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Molecular Formula

102128313 (Gene_ID) P20808/XP_005595839.2 (P22-L199) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TMS1 / ASC Recombinant Rabbit monoclonal Antibody
HA723917 100 µL

TMS1 / ASC Recombinant Rabbit monoclonal Antibody

Ask
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) UBC9 Polyclonal Antibody
MBS7142616 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) UBC9 Polyclonal Antibody

Ask
View Details
Glucokinase (GCK) (NM_033508) Human Tagged ORF Clone Lentiviral Particle
RC218920L3V 200 µL

Glucokinase (GCK) (NM_033508) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
mTOR (Mammalian target of rapamycin, mechanistic target of rapamycin (serine/threonine kinase), FK506-binding Protein 12-rapamycin complex-associated protein 1, FKBP12-rapamycin complex-associated protein, FLJ44809, FRAP, FRAP1, FRAP2, RAFT1, Rapamycin Ta
MBS6245123-01 0.1 mL

mTOR (Mammalian target of rapamycin, mechanistic target of rapamycin (serine/threonine kinase), FK506-binding Protein 12-rapamycin complex-associated protein 1, FKBP12-rapamycin complex-associated protein, FLJ44809, FRAP, FRAP1, FRAP2, RAFT1, Rapamycin Ta

Ask
View Details
mTOR (Mammalian target of rapamycin, mechanistic target of rapamycin (serine/threonine kinase), FK506-binding Protein 12-rapamycin complex-associated protein 1, FKBP12-rapamycin complex-associated protein, FLJ44809, FRAP, FRAP1, FRAP2, RAFT1, Rapamycin Ta
MBS6245123-02 5x 0.1 mL

mTOR (Mammalian target of rapamycin, mechanistic target of rapamycin (serine/threonine kinase), FK506-binding Protein 12-rapamycin complex-associated protein 1, FKBP12-rapamycin complex-associated protein, FLJ44809, FRAP, FRAP1, FRAP2, RAFT1, Rapamycin Ta

Ask
View Details
Lentiviral mouse Czib shRNA (UAS) - Lentiviral mouse Czib shRNA (UAS, iRFP) (25)
GTR15303665 1 Vial

Lentiviral mouse Czib shRNA (UAS) - Lentiviral mouse Czib shRNA (UAS, iRFP) (25)

Ask
View Details