Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-11, Cynomolgus

IL-11 protein is a potent cytokine that significantly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to megakaryocyte maturation and platelet production. It also promotes hepatocyte proliferation in response to liver injury. IL-11 Protein, Cynomolgus is the recombinant cynomolgus-derived IL-11 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-11 Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-11-protein-cynomolgus.html

Purity

97.00

Smiles

PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Molecular Formula

102128313 (Gene_ID) P20808/XP_005595839.2 (P22-L199) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Transforming Growth Factor Beta Induced Protein (TGFbI) ELISA Kit
RD-TGFbI-Mu-01 96 Tests

Mouse Transforming Growth Factor Beta Induced Protein (TGFbI) ELISA Kit

Ask
View Details
Mouse Transforming Growth Factor Beta Induced Protein (TGFbI) ELISA Kit
RD-TGFbI-Mu-02 48 Tests

Mouse Transforming Growth Factor Beta Induced Protein (TGFbI) ELISA Kit

Ask
View Details
Fruquintinib 2mg
A14393-2 2 mg

Fruquintinib 2mg

Ask
View Details
APC_Cy7 Linked Polyclonal Antibody to Early Region 1A Protein (E1A)
MBS2132494-01 0.1 mL

APC_Cy7 Linked Polyclonal Antibody to Early Region 1A Protein (E1A)

Ask
View Details
APC_Cy7 Linked Polyclonal Antibody to Early Region 1A Protein (E1A)
MBS2132494-02 0.2 mL

APC_Cy7 Linked Polyclonal Antibody to Early Region 1A Protein (E1A)

Ask
View Details
APC_Cy7 Linked Polyclonal Antibody to Early Region 1A Protein (E1A)
MBS2132494-03 0.5 mL

APC_Cy7 Linked Polyclonal Antibody to Early Region 1A Protein (E1A)

Ask
View Details