Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-11, Cynomolgus

IL-11 protein is a potent cytokine that significantly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to megakaryocyte maturation and platelet production. It also promotes hepatocyte proliferation in response to liver injury. IL-11 Protein, Cynomolgus is the recombinant cynomolgus-derived IL-11 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-11 Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-11-protein-cynomolgus.html

Purity

97.00

Smiles

PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Molecular Formula

102128313 (Gene_ID) P20808/XP_005595839.2 (P22-L199) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
BNC470204-500 1x 500 µL

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-500 1x 500 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
BNC470096-100 1x 100 µL

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-100 1x 100 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-500 1x 500 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-500 1x 500 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details