Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD93/C1qR1, Human (HEK293, His)

CD93/C1qR1 Protein, Human (HEK293, His) is a recombinant human CD93 produced in HEK293 cells, with His tag. CD93 is a type 1 transmembrane glycoprotein[1].

Product Specifications

Product Name Alternative

CD93/C1qR1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd93-c1q-r1-protein-human-hek293-his.html

Purity

95.0

Smiles

ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKHHHHHH

Molecular Formula

22918 (Gene_ID) Q9NPY3 (A24-K580) (Accession)

Molecular Weight

Approximately 82.5 kDa

References & Citations

[1]Brice Nativel, et al. CD93 is a cell surface lectin receptor involved in the control of the inflammatory response stimulated by exogenous DNA. Immunology. 2019 Oct;158 (2) :85-93.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 8- (4-chlorophenoxy) -2-methylen-octanoate
275228-01 10 mg

Ethyl 8- (4-chlorophenoxy) -2-methylen-octanoate

Sign In for Pricing
View Details
Ethyl 8- (4-chlorophenoxy) -2-methylen-octanoate
275228-02 25 mg

Ethyl 8- (4-chlorophenoxy) -2-methylen-octanoate

Sign In for Pricing
View Details
Ethyl 8- (4-chlorophenoxy) -2-methylen-octanoate
275228-03 50 mg

Ethyl 8- (4-chlorophenoxy) -2-methylen-octanoate

Sign In for Pricing
View Details
Ethyl 8- (4-chlorophenoxy) -2-methylen-octanoate
275228-04 100 mg

Ethyl 8- (4-chlorophenoxy) -2-methylen-octanoate

Sign In for Pricing
View Details
Ethyl 8- (4-chlorophenoxy) -2-methylen-octanoate
275228-05 250 mg

Ethyl 8- (4-chlorophenoxy) -2-methylen-octanoate

Sign In for Pricing
View Details
C1orf126 cDNA Clone
MBS1268898-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

C1orf126 cDNA Clone

Sign In for Pricing
View Details