Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1R1, Cynomolgus (HEK293, His)

IL-1R1 (CD121a) belongs to IL-1 receptor, and binds to IL-1α, IL-1β, IL-1Ra and IL-38 with comparable affinities (Kd: 0.1-1 nM) [1]. IL-1R1 regulates the transcription of multiple proinflammatory cytokines and mediates immune and inflammatory responses, including the activation of NF-κB and MAPK pathway[4]. IL-1R1 Protein, Cynomolgus (HEK293, His) is a recombinant cynomolgus extracellular region of IL-1R1 (M1-T332) with a C-Terminal His tag, which is produced in HEK293 cells.

Product Specifications

Product Name Alternative

IL-1R1 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1r1-protein-cynomolgus-hek293-his.html

Purity

96.30

Smiles

DKCNEREEKIILVSSANEIDVRPCPLNPNEYKGTITWYKNDSKTPISTEQASRIHQHKKKLWFVPAKVEDSGHYYCVVRNSSYCLRIKITAKFVENEPNLCYNAEAIFKQRLPVAGDGGLVCPYMEFFKDENNELPKLLWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETIEVDLGSQIQLICNVTGQLSDTAYWKWNGSFIDEDDPVLGEDYYSVENPANKRRSTLITVLNISETESRFYKHPFTCLARNTHGMDAAYVQLIYPVT

Molecular Formula

711726 (Gene_ID) F7GVA6 (D21-T332) (Accession)

Molecular Weight

Approximately 47-75 kDa

References & Citations

[1]Diana Boraschi, et al. The family of the interleukin-1 receptors. Immunol Rev. 2018 Jan;281 (1) :197-232.|[2]Daniel P Nemeth, et al. Modulation of Neural Networks by Interleukin-1. Brain Plast. 2021 Aug 23;7 (1) :17-32.|[3]Naoe Kaneko, et al. The role of interleukin-1 in general pathology. Inflamm Regen. 2019 Jun 6;39:12.|[4]Yonggang Sha, et al. A role of IL-1R1 signaling in the differentiation of Th17 cells and the development of autoimmune diseases. Self Nonself. 2011 Jan;2 (1) :35-42.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r30 3'UTR GFP Stable Cell Line
TU171914 1.0 mL

Vmn1r30 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lp-PLA2-IN-13
orb1944359-01 25 mg

Lp-PLA2-IN-13

Sign In for Pricing
View Details
Lp-PLA2-IN-13
orb1944359-02 50 mg

Lp-PLA2-IN-13

Sign In for Pricing
View Details
Lp-PLA2-IN-13
orb1944359-03 100 mg

Lp-PLA2-IN-13

Sign In for Pricing
View Details
Lentiviral mouse Rb1 shRNA (UAS) - Lentiviral mouse Rb1 shRNA (UAS, GFP) (100)
GTR15197097 1 Vial

Lentiviral mouse Rb1 shRNA (UAS) - Lentiviral mouse Rb1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
UB2E3 rabbit pAb
ES10436-01 50 µL

UB2E3 rabbit pAb

Sign In for Pricing
View Details