Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein KPLCE (KPLCE)

Product Specifications

Product Name Alternative

KPRP N-terminal and LCE C-terminal-like protein; Skin-specific protein 32

Abbreviation

Recombinant Human KPLCE protein

Gene Name

KPLCE

UniProt

Q5T750

Expression Region

1-250aa

Organism

Homo sapiens (Human)

Target Sequence

MCDQQKQPQFPPSCVKGSGLGAGQGSNGASVKCPVPCQTQTVCVTGPAPCPTQTYVKYQVPCQTQTYVKCPAPCQRTYVKYPTPCQTYVKCPAPCQTTYVKCPTPCQTYVKCPAPCQMTYIKSPAPCQTQTCYVQGASPCQSYYVQAPASGSTSQYCVTDPCSAPCSTSYCCLAPRTFGVSPLRRWIQRPQNCNTGSSGCCENSGSSGCCGSGGCGCSCGCGSSGCCCLGIIPMRSRGPACCDHEDDCCC

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human cellular retinoic acid binding protein 2 polyclonal Antibody
MBS719233-01 0.1 mL

Rabbit anti-human cellular retinoic acid binding protein 2 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human cellular retinoic acid binding protein 2 polyclonal Antibody
MBS719233-02 5x 0.1 mL

Rabbit anti-human cellular retinoic acid binding protein 2 polyclonal Antibody

Sign In for Pricing
View Details
Anti-LPA Antibody (R3A89)
RHC33402 100 μg

Anti-LPA Antibody (R3A89)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB528690 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Cell wall protein TIR4 (TIR4)
MBS1403613-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Cell wall protein TIR4 (TIR4)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Cell wall protein TIR4 (TIR4)
MBS1403613-02 0.02 mg (Yeast)

Recombinant Saccharomyces cerevisiae Cell wall protein TIR4 (TIR4)

Sign In for Pricing
View Details