Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BB/TNFRSF9, Human (HEK293, Fc)

4-1BB/TNFRSF9 Protein, Human (HEK293, Fc), a recombinant human 4-1BB/TNFRSF9 Protein produced in HEK293 cells, has an Fc fragment at the C-terminus. Recombinant Human 4-1BBRTNFRSF9, an inducible T cell molecule belonging to the TNF receptor superfamily, could promote the expansion of antigen-specific T cells and prevent activation-induced death of CD8+ T cells[1].

Product Specifications

Product Name Alternative

4-1BB/TNFRSF9 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bbr-tnfrsf9-protein-human-hek-293-fc.html

Smiles

LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Molecular Formula

3604 (Gene_ID) Q07011 (L24-Q186) (Accession)

Molecular Weight

Approximately 58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Wilcox RA, et al. Provision of antigen and CD137 signaling breaks immunological ignorance, promoting regression of poorly immunogenic tumors. J Clin Invest. 2002 Mar;109 (5) :651-9.|[2]Ye L, et al. CD137, an attractive candidate for the immunotherapy of lung cancer. Cancer Sci. 2020 May;111 (5) :1461-1467.|[3]Jiang P, et al. CD137 promotes bone metastasis of breast cancer by enhancing the migration and osteoclast differentiation of monocytes/macrophages. Theranostics. 2019 May 9;9 (10) :2950-2966.|[4]Geng T, et al. CD137 Signaling Promotes Endothelial Apoptosis by Inhibiting Nrf2 Pathway, and Upregulating NF-κB Pathway. Mediators Inflamm. 2020 Jun 6;2020:4321912.|[5]Langstein J, et al. Comparative analysis of CD137 and LPS effects on monocyte activation, survival, and proliferation. Biochem Biophys Res Commun. 2000 Jun 24;273 (1) :117-22.|[6]Langstein J, et al. Identification of CD137 as a potent monocyte survival factor. J Leukoc Biol. 1999 Jun;65 (6) :829-33.|[7]Jiang D, et al. CD137 induces proliferation of murine hematopoietic progenitor cells and differentiation to macrophages. J Immunol. 2008 Sep 15;181 (6) :3923-32.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
BNC040003-500 1x 500 µL

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-43 + DC10), CF594 conjugate, 0.1mg/mL
S100B (4C4.9), CF405S conjugate, 0.1mg/mL
BNC040143-500 1x 500 µL

S100B (4C4.9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (MYC275), CF740 conjugate, 0.1mg/mL
BNC740275-100 1x 100 µL

C-Myc (MYC275), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details