Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCGB3A2, Mouse (His, GST)

SCGB3A2 is a secreted cytokine-like protein that interacts with pathogens (Listeria monocytogenes, Pseudomonas aeruginosa, yeast) and binds to the scavenger receptor MARCO. It strongly inhibits PLA2G1B activity and regulates lipid metabolism. SCGB3A2 Protein, Mouse (His, GST) is the recombinant mouse-derived SCGB3A2 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

Product Specifications

Product Name Alternative

SCGB3A2 Protein, Mouse (His, GST), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scgb3a2-protein-mouse-his-gst.html

Purity

97.00

Smiles

LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL

Molecular Formula

117158 (Gene_ID) Q920H1-1 (L22-L139) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FGF12 (Fibroblast Growth Factor 12, FGF-12, Fibroblast Growth Factor Homologous Factor 1, FHF-1, Myocyte-activating Factor, FHF1, FGF12B) (MaxLight 405)
MBS6190148-01 0.1 mL

FGF12 (Fibroblast Growth Factor 12, FGF-12, Fibroblast Growth Factor Homologous Factor 1, FHF-1, Myocyte-activating Factor, FHF1, FGF12B) (MaxLight 405)

Ask
View Details
FGF12 (Fibroblast Growth Factor 12, FGF-12, Fibroblast Growth Factor Homologous Factor 1, FHF-1, Myocyte-activating Factor, FHF1, FGF12B) (MaxLight 405)
MBS6190148-02 5x 0.1 mL

FGF12 (Fibroblast Growth Factor 12, FGF-12, Fibroblast Growth Factor Homologous Factor 1, FHF-1, Myocyte-activating Factor, FHF1, FGF12B) (MaxLight 405)

Ask
View Details
4-Amino-N- (2-phenylethyl) benzeneethanamine
430314-01 1 g

4-Amino-N- (2-phenylethyl) benzeneethanamine

Ask
View Details
4-Amino-N- (2-phenylethyl) benzeneethanamine
430314-02 2.5 g

4-Amino-N- (2-phenylethyl) benzeneethanamine

Ask
View Details
Herpes Simplex Virus I, II, Glycoprotein D (HSV I, II) (MaxLight 550)
MBS6254967-01 0.1 mL

Herpes Simplex Virus I, II, Glycoprotein D (HSV I, II) (MaxLight 550)

Ask
View Details
Herpes Simplex Virus I, II, Glycoprotein D (HSV I, II) (MaxLight 550)
MBS6254967-02 5x 0.1 mL

Herpes Simplex Virus I, II, Glycoprotein D (HSV I, II) (MaxLight 550)

Ask
View Details