Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCGB3A2, Mouse (His, GST)

SCGB3A2 is a secreted cytokine-like protein that interacts with pathogens (Listeria monocytogenes, Pseudomonas aeruginosa, yeast) and binds to the scavenger receptor MARCO. It strongly inhibits PLA2G1B activity and regulates lipid metabolism. SCGB3A2 Protein, Mouse (His, GST) is the recombinant mouse-derived SCGB3A2 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

Product Specifications

Product Name Alternative

SCGB3A2 Protein, Mouse (His, GST), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scgb3a2-protein-mouse-his-gst.html

Purity

97.00

Smiles

LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL

Molecular Formula

117158 (Gene_ID) Q920H1-1 (L22-L139) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal HSPH1/HSP105 Antibody [Alexa Fluor 594]
NBP2-97291AF594 0.1 mL

Rabbit Polyclonal HSPH1/HSP105 Antibody [Alexa Fluor 594]

Ask
View Details
Human Receptor II For The Fc Region Of Immunoglobulin G (FcgRII) ELISA Kit
MBS459237-01 48 Tests

Human Receptor II For The Fc Region Of Immunoglobulin G (FcgRII) ELISA Kit

Ask
View Details
Human Receptor II For The Fc Region Of Immunoglobulin G (FcgRII) ELISA Kit
MBS459237-02 96 Tests

Human Receptor II For The Fc Region Of Immunoglobulin G (FcgRII) ELISA Kit

Ask
View Details
Human Receptor II For The Fc Region Of Immunoglobulin G (FcgRII) ELISA Kit
MBS459237-03 5x 96 Tests

Human Receptor II For The Fc Region Of Immunoglobulin G (FcgRII) ELISA Kit

Ask
View Details
Human Receptor II For The Fc Region Of Immunoglobulin G (FcgRII) ELISA Kit
MBS459237-04 10x 96 Tests

Human Receptor II For The Fc Region Of Immunoglobulin G (FcgRII) ELISA Kit

Ask
View Details
Mouse Monoclonal MERS-CoV Spike Protein Antibody (02) [Alexa Fluor 532]
NBP3-06409AF532 0.1 mL

Mouse Monoclonal MERS-CoV Spike Protein Antibody (02) [Alexa Fluor 532]

Ask
View Details