Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD70, Rat (HEK293, His)

CD70 is the ligand of CD27 in activated T and B lymphocytes, is an important cytokine in CD70-CD27 pathway involving with the generation and maintenance of T cell immunity[1]. CD70 is a surface antigen, also shows antiviral activity and regulates viability of tumor cells and regulatory T cells[2][3]. As for CD70 protein in rat contains TNF_2 domain (57-188 a.a) and transmembrane helix, belonging to the tumor necrosis factor (TNF) family. CD70 Protein, Rat (HEK293, His) is 150 amino acids in length (Q46-P195) and is expressed in the HEK293 cells with N terminal His-tag.

Product Specifications

Product Name Alternative

CD70 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd70-protein-rat-hek293-his.html

Purity

95.70

Smiles

QHVLLEPPELHVAELQLNLTDPQKDLTLRWGAGPALGRSFTHGPGLEKGNLRIHQDGIYRLHIQVTLANCSSSGSALQHRASLVVGICSPAVHIISLLRRRFGQDCTVSLQRLTPLARGDVLCSNLTQPLLPSRNADETFFGVQRVYPWP

Molecular Formula

301132 (Gene_ID) NP_001100348 (Q46-P195) (Accession)

Molecular Weight

Approximately 28 kDa

References & Citations

[1]Bowman MR, et al. The cloning of CD70 and its identification as the ligand for CD27. J Immunol. 1994 Feb 15;152 (4) :1756-61.|[2]Jacobs J, et al. CD70: An emerging target in cancer immunotherapy. Pharmacol Ther. 2015 Nov;155:1-10.|[3]Izawa K, et al. Inherited CD70 deficiency in humans reveals a critical role for the CD70-CD27 pathway in immunity to Epstein-Barr virus infection. J Exp Med. 2017 Jan;214 (1) :73-89.|[4]Brown GR, et al. CD27-CD27 ligand/CD70 interactions enhance alloantigen-induced proliferation and cytolytic activity in CD8+ T lymphocytes. J Immunol. 1995 Apr 15;154 (8) :3686-95.|[5]Kobata T, et al. CD27-CD70 interactions regulate B-cell activation by T cells. Proc Natl Acad Sci U S A. 1995 Nov 21;92 (24) :11249-53.|[6]Jin L, et al. CD70, a novel target of CAR T-cell therapy for gliomas. Neuro Oncol. 2018 Jan 10;20 (1) :55-65.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Leptin (LEP) ELISA Kit
RD-LEP-c-01 96 Tests

Canine Leptin (LEP) ELISA Kit

Sign In for Pricing
View Details
Canine Leptin (LEP) ELISA Kit
RD-LEP-c-02 48 Tests

Canine Leptin (LEP) ELISA Kit

Sign In for Pricing
View Details
SRC Human Gene Knockout Kit (CRISPR)
KN208622 1 Kit

SRC Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human OR51T1 activation kit by CRISPRa
GA118346 1 Kit

Human OR51T1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR561773 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
SRC (NM_005417) Human Recombinant Protein
TP710026 20 µg

SRC (NM_005417) Human Recombinant Protein

Sign In for Pricing
View Details