Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Rat (CHO)

IL-5 Protein, Rat (CHO), a CHO cell derived cytokine, stimulates B cell growth and increases immunoglobulin secretion.

Product Specifications

Product Name Alternative

IL-5 Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-rat-cho.html

Purity

96.00

Smiles

MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV

Molecular Formula

24497 (Gene_ID) Q08125 (M20-V132) (Accession)

Molecular Weight

Approximately 13-21 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Seow HF, et al. Cloning and sequencing of an ovine interleukin-5 cDNA. DNA Seq. 1996;6 (6) :331-5.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat CD59 ELISA Kit
SEKR-0159-01 48 Tests

Rat CD59 ELISA Kit

Ask
View Details
Rat CD59 ELISA Kit
SEKR-0159-02 96 Tests

Rat CD59 ELISA Kit

Ask
View Details
COPS3 (COP9 Signalosome Complex Subunit 3, SGN3, Signalosome Subunit 3, AB1-Containing Signalosome Subunit 3, COPS 3, CSN3) discontinued
221826-01 50 µL

COPS3 (COP9 Signalosome Complex Subunit 3, SGN3, Signalosome Subunit 3, AB1-Containing Signalosome Subunit 3, COPS 3, CSN3) discontinued

Ask
View Details
COPS3 (COP9 Signalosome Complex Subunit 3, SGN3, Signalosome Subunit 3, AB1-Containing Signalosome Subunit 3, COPS 3, CSN3) discontinued
221826-02 100 µL

COPS3 (COP9 Signalosome Complex Subunit 3, SGN3, Signalosome Subunit 3, AB1-Containing Signalosome Subunit 3, COPS 3, CSN3) discontinued

Ask
View Details
Guanine nucleotide binding protein, beta 5 Subunit (Gbeta5, GB5, Gbeta5, Guanine nucleotide-binding protein subunit beta-5, Transducin beta Chain 5) (MaxLight 550)
G9039-35A-ML550 100 µL

Guanine nucleotide binding protein, beta 5 Subunit (Gbeta5, GB5, Gbeta5, Guanine nucleotide-binding protein subunit beta-5, Transducin beta Chain 5) (MaxLight 550)

Ask
View Details
Hbp1 (NM_177993) Mouse Tagged Lenti ORF Clone
MR224494L4 10 µg

Hbp1 (NM_177993) Mouse Tagged Lenti ORF Clone

Ask
View Details