Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gasdermin-D (Gsdmd), partial

Product Specifications

Product Name Alternative

Gasdermin domain-containing protein 1

Abbreviation

Recombinant Mouse Gsdmdc1 protein, partial

Gene Name

Gsdmdc1

UniProt

Q9D8T2

Expression Region

277-487aa

Organism

Mus musculus (Mouse)

Target Sequence

GIDEEELIEAADFQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQKPC

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Precursor of a pore-forming protein that plays a key role in host defense against pathogen infection and danger signals (PubMed:26375003, PubMed:26375259, PubMed:26611636, PubMed:27383986, PubMed:27385778, PubMed:27418190) . This form constitutes the precursor of the pore-forming protein: upon cleavage, the released N-terminal moiety (Gasdermin-D, N-terminal) binds to membranes and forms pores, triggering pyroptosis (PubMed:26375003, PubMed:26375259, PubMed:26611636, PubMed:27383986, PubMed:27385778, PubMed:27418190) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.4 kDa

References & Citations

"Gasdermin D is an executor of pyroptosis and required for interleukin-1beta secretion." He W.T., Wan H., Hu L., Chen P., Wang X., Huang Z., Yang Z.H., Zhong C.Q., Han J. Cell Res. 25:1285-1298 (2015)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCY10 Human Gene Knockout Kit (CRISPR)
KN414876 1 Kit

ADCY10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
trans-Clopenthixol-d4 (-)-10-Camphorsulfonic Acid Salt
TRC-C587192-1MG 1 mg

trans-Clopenthixol-d4 (-)-10-Camphorsulfonic Acid Salt

Sign In for Pricing
View Details
Human PSA Antibody Pair Set
E-KAB-0136 50 µL & 100 µg

Human PSA Antibody Pair Set

Sign In for Pricing
View Details
4-(3,5-Difluorophenyl)aniline
TRC-D451220-250MG 250 mg

4-(3,5-Difluorophenyl)aniline

Sign In for Pricing
View Details
Automatic Demulsibility Characteristics Tester BPTL-261
BPTL-261 1 Unit

Automatic Demulsibility Characteristics Tester BPTL-261

Sign In for Pricing
View Details
Spint2 (NM_001082548) Mouse Tagged ORF Clone
MG201901 10 µg

Spint2 (NM_001082548) Mouse Tagged ORF Clone

Sign In for Pricing
View Details