Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCVRN, Human (sf9, His-Myc)

The RCVRN protein is a calcium sensor that regulates phototransduction in cone and rod photoreceptors, enhancing the light sensitivity of cone photoreceptors in dark conditions. Under low light, it prolongs RHO/rhodopsin activation in rod photoreceptor cells by inhibiting GRK1-mediated phosphorylation. RCVRN Protein, Human (sf9, His-Myc) is the recombinant human-derived RCVRN protein, expressed by sf9 insect cells , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

RCVRN Protein, Human (sf9, His-Myc), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcvrn-protein-human-baculovirus-his-myc.html

Smiles

GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Molecular Formula

5957 (Gene_ID) P35243 (G2-A200) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diphenylacetylene
TRC-D493398-1G 1 g

Diphenylacetylene

Sign In for Pricing
View Details
(S)-Lofexidine
TRC-L469400-2.5MG 2.5 mg

(S)-Lofexidine

Sign In for Pricing
View Details
MARCKS pSer170 Rabbit Polyclonal Antibody
AP09469PU-S 50 µL

MARCKS pSer170 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RACK1 Recombinant Rabbit Monoclonal Antibody [JG40-26]
ET7109-04 100 µL

RACK1 Recombinant Rabbit Monoclonal Antibody [JG40-26]

Sign In for Pricing
View Details
ZNF114 Mouse Monoclonal Antibody [Clone ID: OTI6F4]
CF809103 100 µg

ZNF114 Mouse Monoclonal Antibody [Clone ID: OTI6F4]

Sign In for Pricing
View Details
ZNF688 (NM_001024683) Human Over-expression Lysate
LY422536 100 µg

ZNF688 (NM_001024683) Human Over-expression Lysate

Sign In for Pricing
View Details