Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCVRN, Human (sf9, His-Myc)

The RCVRN protein is a calcium sensor that regulates phototransduction in cone and rod photoreceptors, enhancing the light sensitivity of cone photoreceptors in dark conditions. Under low light, it prolongs RHO/rhodopsin activation in rod photoreceptor cells by inhibiting GRK1-mediated phosphorylation. RCVRN Protein, Human (sf9, His-Myc) is the recombinant human-derived RCVRN protein, expressed by sf9 insect cells , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

RCVRN Protein, Human (sf9, His-Myc), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcvrn-protein-human-baculovirus-his-myc.html

Smiles

GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Molecular Formula

5957 (Gene_ID) P35243 (G2-A200) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp119b Mouse Gene Knockout Kit (CRISPR)
KN519726 1 Kit

Zfp119b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PLOD3 (NM_001084) Human Over-expression Lysate
LC421265 20 µg

PLOD3 (NM_001084) Human Over-expression Lysate

Sign In for Pricing
View Details
5-Oxo-L-proline-d5
TRC-O858977-1MG 1 mg

5-Oxo-L-proline-d5

Sign In for Pricing
View Details
OR2K2 Antibody
8G555-AAT 50 µg

OR2K2 Antibody

Sign In for Pricing
View Details
CBX3 Antibody
KC-6253-01 50 μL

CBX3 Antibody

Sign In for Pricing
View Details
CBX3 Antibody
KC-6253-02 100 µL

CBX3 Antibody

Sign In for Pricing
View Details