Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GARP&Latent TGF Beta-1 Complex, Human (HEK293, His, Strep)

LRRC32 is a key regulator of TGF-β activation and maintains TGFB1, TGFB2, and TGFB3 in the latent state during extracellular storage by binding to latency-associated peptide (LAP) . LRRC32 competes with LTBP1 for LAP binding and effectively regulates integrin-dependent TGF-β activation. GARP&Latent TGF Beta-1 Complex Protein, Human (HEK293, His, Strep) is a recombinant protein dimer complex containing human-derived GARP&Latent TGF Beta-1 Complex protein, expressed by HEK293 , with N-6*His, C-3*Strep labeled tag. GARP&Latent TGF Beta-1 Complex Protein, Human (HEK293, His, Strep), has molecular weight of 10-14 & 35-50 & 85-95 kDa, respectively.

Product Specifications

Product Name Alternative

GARP&Latent TGF Beta-1 Complex Protein, Human (HEK293, His, Strep), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/garp-latent-tgf-beta-1-complex-protein-human-hek-293-his-strep.html

Purity

95.0

Smiles

LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS&HQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQLRSILASPLGFYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGLLERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFEGLPRLTHLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQPQAEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLPTGPPQDSKGIHAPSEGWSALPLSAPSGNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEARRLGSLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGNRVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLEVATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNIN

Molecular Formula

7040&2615 (Gene_ID) P01137&Q14392 (L30-S390&H20-N627) (Accession)

Molecular Weight

10-14&35-50&85-95 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
BNC940218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-500 1x 500 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-500 1x 500 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF568 conjugate, 0.1mg/mL
BNC682385-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF405S conjugate, 0.1mg/mL
BNC041819-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF647 conjugate, 0.1mg/mL
BNC472312-100 1x 100 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details