Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLT3LG, Mouse (HEK293, Fc)

FLT3LG protein, a potent stimulator, activates FLT3, synergizing with colony-stimulating factors and interleukins. Its homodimeric form, especially in the soluble isoform, effectively promotes the expansion and differentiation of hematopoietic progenitor cells. The protein's significance lies in orchestrating key processes within the hematopoietic system. FLT3LG Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived FLT3LG protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

FLT3LG Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/flt3lg-protein-mouse-188a-a-hek293-fc.html

Purity

98.0

Smiles

GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQ

Molecular Formula

14256 (Gene_ID) P49772-1 (G27-Q189) (Accession)

Molecular Weight

Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin A1 Antibody
8C0166-AAT 50 µg

Cyclin A1 Antibody

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF640R conjugate, 0.1mg/mL
BNC402337-100 1x 100 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Water Chiller BCHI-402
BCHI-402 Each

Water Chiller BCHI-402

Sign In for Pricing
View Details
Cyclin A2 (S- & G2-phase Cyclin) (CCNA2/2333), CF488A conjugate, 0.1mg/mL
BNC882333-100 1x 100 µL

Cyclin A2 (S- & G2-phase Cyclin) (CCNA2/2333), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKR1CL1 Antibody
8C14397-AAT 50 µg

AKR1CL1 Antibody

Sign In for Pricing
View Details
RERG (NM_001190726) Human Over-expression Lysate
LC434024 20 µg

RERG (NM_001190726) Human Over-expression Lysate

Sign In for Pricing
View Details