Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD8 alpha, Rat (HEK293, Fc)

CD8 alpha is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs.It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways.CD8 alpha Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD8 alpha protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD8 alpha Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd8-alpha-protein-rat-hek293-fc.html

Purity

98.0

Smiles

QLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIY

Molecular Formula

24930 (Gene_ID) P07725 (Q27-Y189) (Accession)

Molecular Weight

Approximately 50-56 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEG3 ORF Vector (Human) (pORF)
36377011 1.0 µg DNA

PEG3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
APC1 discontinued
341860-01 100 µL

APC1 discontinued

Sign In for Pricing
View Details
APC1 discontinued
341860-02 200 µL

APC1 discontinued

Sign In for Pricing
View Details
CD44v10 Rabbit Polyclonal Antibody (BF750)
orb1591433 100 µL

CD44v10 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
CLIC4, NT (Chloride Intracellular Channel Protein 4, Intracellular Chloride Ion Channel Protein p64H1, CLIC4) discontinued
C5840-45E 50 µg

CLIC4, NT (Chloride Intracellular Channel Protein 4, Intracellular Chloride Ion Channel Protein p64H1, CLIC4) discontinued

Sign In for Pricing
View Details
RPRM ELISA Kit (Human)
OKEH01126-96W 96 Well

RPRM ELISA Kit (Human)

Sign In for Pricing
View Details