Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS2, Human (R255Q, HEK293, His)

The TMPRSS2 protein is a plasma membrane-anchored serine protease that plays critical roles in prostate physiology, cancer metastasis, pain modulation, and viral infection. Its lytic activity affects proteolytic cascades involved in prostate function, and androgen-induced activation contributes to cancer progression. TMPRSS2 Protein, Human (R255Q, HEK293, His) is the recombinant human-derived TMPRSS2 protein, expressed by HEK293 , with N-10*His labeled tag and R255Q mutation.

Product Specifications

Product Name Alternative

TMPRSS2 Protein, Human (R255Q, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmprss2-protein-human-r255q-hek-293-his.html

Purity

95.0

Smiles

WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSQIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

Molecular Formula

7113 (Gene_ID) O15393-1 (W106-G492, R255Q) (Accession)

Molecular Weight

Approximately 46.71 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR6J1 siRNA Oligos set (Human)
35511171 3x 5 nmol

OR6J1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
HIST1H4E sgRNA CRISPR Lentivector (Human) (Target 1)
K0959302 1.0 µg DNA

HIST1H4E sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PLA2G5 Polyclonal Antibody
MBS9433077-01 0.05 mL

PLA2G5 Polyclonal Antibody

Sign In for Pricing
View Details
PLA2G5 Polyclonal Antibody
MBS9433077-02 0.1 mL

PLA2G5 Polyclonal Antibody

Sign In for Pricing
View Details
PLA2G5 Polyclonal Antibody
MBS9433077-03 5x 0.1 mL

PLA2G5 Polyclonal Antibody

Sign In for Pricing
View Details
GPR10 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-11803R-BF594 100 µL

GPR10 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details