Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB1B, Human (HEK293, Fc)

The RAB1B protein is an important small GTPase that regulates intracellular membrane trafficking by coordinating vesicular processes through cycling between GDP and GTP forms. It recruits downstream effectors to achieve vesicle functions, including formation, movement, and fusion. RAB1B Protein, Human (HEK293, Fc) is the recombinant human-derived RAB1B protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

RAB1B Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rab1b-protein-human-hek293-fc.html

Purity

97.90

Smiles

MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGG

Molecular Formula

81876 (Gene_ID) Q9H0U4 (M1-G199) (Accession)

Molecular Weight

Approximately 58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKKgamma Polyclonal Antibody
MBS2535344-01 0.02 mL

IKKgamma Polyclonal Antibody

Sign In for Pricing
View Details
IKKgamma Polyclonal Antibody
MBS2535344-02 0.06 mL

IKKgamma Polyclonal Antibody

Sign In for Pricing
View Details
IKKgamma Polyclonal Antibody
MBS2535344-03 0.12 mL

IKKgamma Polyclonal Antibody

Sign In for Pricing
View Details
IKKgamma Polyclonal Antibody
MBS2535344-04 0.2 mL

IKKgamma Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae YLR281C Protein (aa 18-155) [His]
VAng-Wyb6250-1mg 1 mg

Recombinant Saccharomyces Cerevisiae YLR281C Protein (aa 18-155) [His]

Sign In for Pricing
View Details
FBXL19, CT (FBXL19, FBL19, F-box/LRR-repeat protein 19, F-box and leucine-rich repeat protein 19) (MaxLight 750)
MBS6298272-01 0.1 mL

FBXL19, CT (FBXL19, FBL19, F-box/LRR-repeat protein 19, F-box and leucine-rich repeat protein 19) (MaxLight 750)

Sign In for Pricing
View Details