IL-15R alpha, Human (142a.a, HEK293, Fc)
IL-15R alpha is a high affinity receptor for IL-15 (Kd: 100 pM) [1]. IL-15R alpha binds IL-15 and thereby activating the antitumor functions of NK cells and CD8+ T cells[2]. IL-15R alpha plays an important role in memory CD8+ T cell homeostasis and lymphocyte development[3]. IL-15R alpha Protein, Human (142a.a, HEK293, Fc) is a recombinant human extracellular region of IL-15R alpha (I31-T172) with a C-Terminal Fc tag, which is produced in HEK293 cells.
Product Specifications
Product Name Alternative
IL-15R alpha Protein, Human (142a.a, HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-15r-alpha-protein-human-142a-a-hek293-fc.html
Smiles
ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIKPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
Molecular Formula
3601 (Gene_ID) Q13261-3 (I31-T172) (Accession)
Molecular Weight
Approximately 60-75 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog