Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Metallothionein-3 (Mt3)

Product Specifications

Product Name Alternative

Growth inhibitory factor Short name: GIF

Abbreviation

Recombinant Mouse Mt3 protein

Gene Name

Mt3

UniProt

P28184

Expression Region

1-68aa

Organism

Mus musculus (Mouse)

Target Sequence

MDPETCPCPTGGSCTCSDKCKCKGCKCTNCKKSCCSCCPAGCEKCAKDCVCKGEEGAKAEAEKCSCCQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.5 kDa

References & Citations

"Three-dimensional structure and dynamics of a brain specific growth inhibitory factor: metallothionein-3." Oz G., Zangger K., Armitage I.M. Biochemistry 40:11433-11441 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Degs1 (NM_007853) Mouse Tagged Lenti ORF Clone
MR204702L3 10 µg

Degs1 (NM_007853) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SLC17A9 3'UTR GFP Stable Cell Line
TU073427 1.0 mL

SLC17A9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CD5, ID (CD5, LEU1, T-cell surface glycoprotein CD5, Lymphocyte antigen T1/Leu-1, CD5) (AP) discontinued
033522-AP 200 µL

CD5, ID (CD5, LEU1, T-cell surface glycoprotein CD5, Lymphocyte antigen T1/Leu-1, CD5) (AP) discontinued

Sign In for Pricing
View Details
Phospho-c-Jun (Thr91+Thr93) Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62758R-PerCP-Cy5.5 100 µL

Phospho-c-Jun (Thr91+Thr93) Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal LPAR1/LPA1/EDG-2 Antibody [Alexa Fluor 405]
NBP1-03363AF405 0.1 mL

Rabbit Polyclonal LPAR1/LPA1/EDG-2 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Rat Ankyrin B, Ank-B ELISA Kit
MBS7254816-01 48 Well

Rat Ankyrin B, Ank-B ELISA Kit

Sign In for Pricing
View Details