Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPTX1, Human (HEK293, His)

The NPTX1 protein may mediate synaptic processes and may be involved in the uptake of synaptic substances during synaptic remodeling or the clustering of AMPA glutamate receptors at specific excitatory synapses. Its involvement suggests a role in dynamic regulation of synaptic structure and function. NPTX1 Protein, Human (HEK293, His) is the recombinant human-derived NPTX1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NPTX1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nptx1-protein-human-hek-293-his.html

Purity

95.0

Smiles

QDFGPTRFICTSVPVDADMCAASVAAGGAEELRSSVLQLRETVLQQKETILSQKETIRELTAKLGRCESQSTLDPGAGEARAGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSATPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGSGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIAWAESHIEIYGGATKWTFEACRQIN

Molecular Formula

4884 (Gene_ID) Q15818 (Q23-N432) (Accession)

Molecular Weight

50-55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDHD1A, 1-228aa, Human, His tag, E Coli
MBS203998-01 0.02 mg

HDHD1A, 1-228aa, Human, His tag, E Coli

Sign In for Pricing
View Details
HDHD1A, 1-228aa, Human, His tag, E Coli
MBS203998-02 0.1 mg

HDHD1A, 1-228aa, Human, His tag, E Coli

Sign In for Pricing
View Details
HDHD1A, 1-228aa, Human, His tag, E Coli
MBS203998-03 5x 0.02 mg

HDHD1A, 1-228aa, Human, His tag, E Coli

Sign In for Pricing
View Details
HDHD1A, 1-228aa, Human, His tag, E Coli
MBS203998-04 0.5 mg

HDHD1A, 1-228aa, Human, His tag, E Coli

Sign In for Pricing
View Details
HDHD1A, 1-228aa, Human, His tag, E Coli
MBS203998-05 5x 0.1 mg

HDHD1A, 1-228aa, Human, His tag, E Coli

Sign In for Pricing
View Details
HDHD1A, 1-228aa, Human, His tag, E Coli
MBS203998-06 5x 0.5 mg

HDHD1A, 1-228aa, Human, His tag, E Coli

Sign In for Pricing
View Details